Recombinant Human EPGN protein

Cat.No. : EPGN-131H
Product Overview : Recombinant Human EPGN protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 72
Description : Epigen is a member of the epidermal growth factor family and is expressed by several tissues, including the testis, liver, heart and in certain tumor cells. It is strongly mitogenic for fibroblasts and epithelial cells, despite its relatively weak affinity for its main receptor, ErbB1. The mitogenic potential of Epigen is enhanced by its unusually long persistence on the membrane before ubiquitylation and receptor-mediated depletion. The gene of human Epigen encodes a 154 amino acid (a.a.) residue type I transmembrane precursor glycoprotein which contains a 22 a.a. signal peptide, an 88 a.a. extracellular domain, a 21 a.a. transmembrane domain and a 23 a.a. cytoplasmic domain. By alternative splicing of the gene, Epigen has several isoforms. The mature, shed form of human Epigen (54 – 104a.a.) shares 92 %, 94 % and 94 % a.a. sequence identity with mouse, rat and equine Epigen, respectively.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 300 ng/ml, corresponding to a specific activity of > 3.3 × 10³ IU/mg.
Molecular Mass : Approximately 7.9 kDa monomeric protein, containing 72 amino acid residues, which comprises the EGF homologous portion of the Epigen precursor.
AA Sequence : AVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA
Endotoxin : Less than 1 EU/μg of rHuEpigen as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name EPGN
Official Symbol EPGN
Synonyms EPGN; epithelial mitogen homolog (mouse); epigen; ALGV3072; EPG; PRO9904; FLJ75542;
Gene ID 255324
mRNA Refseq NM_001013442
Protein Refseq NP_001013460
UniProt ID Q6UW88

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EPGN Products

Required fields are marked with *

My Review for All EPGN Products

Required fields are marked with *

0
cart-icon
0
compare icon