Recombinant Human EPGN Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | EPGN-4830H |
Product Overview : | EPGN MS Standard C13 and N15-labeled recombinant protein (NP_001013460) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of the epidermal growth factor family. Members of this family are ligands for the epidermal growth factor receptor and play a role in cell survival, proliferation and migration. This protein has been reported to have high mitogenic activity but low affinity for its receptor. Expression of this transcript and protein have been reported in cancer specimens of the breast, bladder, and prostate. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 14.6 kDa |
AA Sequence : | MALGVPISVYLLFNAMTALTEEAAVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYAVDSYEKYIAIGIGVGLLLSGFLVIFYCYIRKRYEKDKITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | EPGN epithelial mitogen [ Homo sapiens (human) ] |
Official Symbol | EPGN |
Synonyms | EPGN; epithelial mitogen homolog (mouse); epigen; ALGV3072; EPG; PRO9904; FLJ75542; |
Gene ID | 255324 |
mRNA Refseq | NM_001013442 |
Protein Refseq | NP_001013460 |
MIM | 618717 |
UniProt ID | Q6UW88 |
◆ Recombinant Proteins | ||
Epgn-2174M | Recombinant Mouse Epgn Protein, His-tagged | +Inquiry |
EPGN-1894C | Recombinant Chicken EPGN | +Inquiry |
EPGN-235H | Recombinant Human EPGN Protein, His-tagged | +Inquiry |
Epgn-2175R | Recombinant Rat Epgn Protein, His-tagged | +Inquiry |
EPGN-2332H | Recombinant Human EPGN, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPGN-249HCL | Recombinant Human EPGN lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPGN Products
Required fields are marked with *
My Review for All EPGN Products
Required fields are marked with *
0
Inquiry Basket