Active Recombinant Human EPGN protein

Cat.No. : EPGN-014H
Product Overview : Recombinant Human EPGN was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : The protein encoded by this gene is a member of the epidermal growth factor family. Members of this family are ligands for the epidermal growth factor receptor and play a role in cell survival, proliferation and migration. This protein has been reported to have high mitogenic activity but low affinity for its receptor. Expression of this transcript and protein have been reported in cancer specimens of the breast, bladder, and prostate. Alternative splicing results in multiple transcript variants
Form : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bio-activity : Determined by the dose-dependent stimulation of the proliferation of murine Balb/3T3 cells. The expected ED50 for this effect is 150-300 ng/ml.
Molecular Mass : 7.9 kDa
AA Sequence : AVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Resuspend the protein in the desired concentration in proper buffer
Gene Name EPGN epithelial mitogen [ Homo sapiens (human) ]
Official Symbol EPGN
Synonyms EPG; PRO9904; ALGV3072; EPGN;
Gene ID 255324
mRNA Refseq NM_001013442
Protein Refseq NP_001013460
UniProt ID Q6UW88

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EPGN Products

Required fields are marked with *

My Review for All EPGN Products

Required fields are marked with *

0
cart-icon