Recombinant E.coli Fpg, His-tagged

• Cat.No.: mutM-88E
• Product Overview: Recombinant E. coli Formamidopyrimidine-DNA Glycosylase/Fpg is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Lys269) of E. coli Fpg.

Specification

• Species: E.coli
• Source: E.coli
• Tag: His
• Protein Length: 1-269 a.a.
• Description: Fpg Acts as DNA glycosylase that releases damaged bases preferentially from duplex DNA. It has an associated class I AP(apurinic/apyrimidinic) lyase activity.Fpg Cleaves the DNA backbone to generate a single-strand break at the site of the removed base, The C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving 3' and 5' phosphoryl groups.
• Form: Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 100mM NaCl, 1mM EDTA, 1mM DTT, 50% Glycerol, pH 7.8
• AA Sequence: MPELPEVETSRRGIEPHLVGATILHAVVRNGRLRWPVSEEIYRLSDQPVLSVQRRAKYLLLELPE GWIIIHLGMSGSLRILPEELPPEKHDHVDLVMSNGKVLRYTDPRRFGAWLWTKELEGHNVLTHLG PEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSLAEC ELLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRA TFYCRQCQKLEHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Store at < -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles.