Recombinant E.coli Fpg, His-tagged

Cat.No. : mutM-88E
Product Overview : Recombinant E. coli Formamidopyrimidine-DNA Glycosylase/Fpg is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Lys269) of E. coli Fpg.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : His
Protein Length : 1-269 a.a.
Description : Fpg Acts as DNA glycosylase that releases damaged bases preferentially from duplex DNA. It has an associated class I AP(apurinic/apyrimidinic) lyase activity.Fpg Cleaves the DNA backbone to generate a single-strand break at the site of the removed base, The C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving 3' and 5' phosphoryl groups.
Form : Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 100mM NaCl, 1mM EDTA, 1mM DTT, 50% Glycerol, pH 7.8
AA Sequence : MPELPEVETSRRGIEPHLVGATILHAVVRNGRLRWPVSEEIYRLSDQPVLSVQRRAKYLLLELPE GWIIIHLGMSGSLRILPEELPPEKHDHVDLVMSNGKVLRYTDPRRFGAWLWTKELEGHNVLTHLG PEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSLAEC ELLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRA TFYCRQCQKLEHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Store at < -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All mutM Products

Required fields are marked with *

My Review for All mutM Products

Required fields are marked with *

0
cart-icon