Recombinant E.coli Fpg, His-tagged
Cat.No. : | mutM-88E |
Product Overview : | Recombinant E. coli Formamidopyrimidine-DNA Glycosylase/Fpg is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Lys269) of E. coli Fpg. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-269 a.a. |
Description : | Fpg Acts as DNA glycosylase that releases damaged bases preferentially from duplex DNA. It has an associated class I AP(apurinic/apyrimidinic) lyase activity.Fpg Cleaves the DNA backbone to generate a single-strand break at the site of the removed base, The C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving 3' and 5' phosphoryl groups. |
Form : | Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 100mM NaCl, 1mM EDTA, 1mM DTT, 50% Glycerol, pH 7.8 |
AA Sequence : | MPELPEVETSRRGIEPHLVGATILHAVVRNGRLRWPVSEEIYRLSDQPVLSVQRRAKYLLLELPE GWIIIHLGMSGSLRILPEELPPEKHDHVDLVMSNGKVLRYTDPRRFGAWLWTKELEGHNVLTHLG PEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSLAEC ELLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRA TFYCRQCQKLEHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at < -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles. |
◆ Recombinant Proteins | ||
MUTM-0829B | Recombinant Bacillus subtilis MUTM protein, His-tagged | +Inquiry |
mutM-52E | Active Recombinant E.coli mutM | +Inquiry |
mutM-88E | Recombinant E.coli Fpg, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All mutM Products
Required fields are marked with *
My Review for All mutM Products
Required fields are marked with *