Recombinant E.coli LacI, His-tagged lacI-89E

Recombinant E.coli LacI, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant E.coli LacI, His-tagged

Recombinant E.coli LacI, His-tagged

lacI Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : lacI-89E
Product Overview : Recombinant E.coli Lactose operon repressor/LacI is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Gln360) of E.coli LacI fused with a 6His tag at the C-terminus.
Description : Lactose operon repressor (LacI) contains one HTH lacI-type DNA-binding domain, functions as a homotetramer. Lactose operon repressor as a repressor of the lactose operon, which also as an inducer, binds allolactose. If remove residues 1-59, resulting the loss of DNA-binding activity but retains tetrameric structure and inducer-binding activity. If delete residues 340-360, resulting the loss of tetramer formation, but retains dimer formation, inducer-binding activity, and DNA-binding activity.
Source : E. coli
Species : E. coli
Tag : His
Form : Supplied as a 0.2 μM filtered solution of 20mM Tris, 300mM NaCl, 5mM DTT pH 8.0
AA Sequence : MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSLLIG VATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDD QDAIAVEAACTNVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSAR LRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITES GLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVK RKTTLAPNTQTASPRALADSLMQLARQVSRLESGQHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Store at < -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles.

Related Gene

lacI

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy