"lacI" Related Products

Recombinant E.coli LacI, His-tagged

Cat.No.: lacI-89E
Product Overview: Recombinant E.coli Lactose operon repressor/LacI is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Gln360) of E.coli LacI fused with a 6His tag at the C-terminus.
Description: Lactose operon repressor (LacI) contains one HTH lacI-type DNA-binding domain, functions as a homotetramer. Lactose operon repressor as a repressor of the lactose operon, which also as an inducer, binds allolactose. If remove residues 1-59, resulting the loss of DNA-binding activity but retains tetrameric structure and inducer-binding activity. If delete residues 340-360, resulting the loss of tetramer formation, but retains dimer formation, inducer-binding activity, and DNA-binding activity.
Source: E. coli
Species: E. coli
Tag: His
Form: Supplied as a 0.2 μM filtered solution of 20mM Tris, 300mM NaCl, 5mM DTT pH 8.0
AA Sequence: MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSLLIG VATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDD QDAIAVEAACTNVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSAR LRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITES GLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVK RKTTLAPNTQTASPRALADSLMQLARQVSRLESGQHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Store at < -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles.

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.