Recombinant E.coli LacI, His-tagged
Cat.No. : | lacI-89E |
Product Overview : | Recombinant E.coli Lactose operon repressor/LacI is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Gln360) of E.coli LacI fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-360 a.a. |
Description : | Lactose operon repressor (LacI) contains one HTH lacI-type DNA-binding domain, functions as a homotetramer. Lactose operon repressor as a repressor of the lactose operon, which also as an inducer, binds allolactose. If remove residues 1-59, resulting the loss of DNA-binding activity but retains tetrameric structure and inducer-binding activity. If delete residues 340-360, resulting the loss of tetramer formation, but retains dimer formation, inducer-binding activity, and DNA-binding activity. |
Form : | Supplied as a 0.2 μM filtered solution of 20mM Tris, 300mM NaCl, 5mM DTT pH 8.0 |
AA Sequence : | MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSLLIG VATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDD QDAIAVEAACTNVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSAR LRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITES GLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVK RKTTLAPNTQTASPRALADSLMQLARQVSRLESGQHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at < -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles. |
◆ Recombinant Proteins | ||
lacI-89E | Recombinant E.coli LacI, His-tagged | +Inquiry |
lacI-4255E | Recombinant Escherichia coli lacI protein, His-SUMO-tagged | +Inquiry |
lacI-90E | Recombinant Escherichia coli (strain K12) lacI protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lacI Products
Required fields are marked with *
My Review for All lacI Products
Required fields are marked with *
0
Inquiry Basket