Recombinant E.coli LacI, His-tagged
| Cat.No. : | lacI-89E | 
| Product Overview : | Recombinant E.coli Lactose operon repressor/LacI is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Gln360) of E.coli LacI fused with a 6His tag at the C-terminus. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | E.coli | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 1-360 a.a. | 
| Description : | Lactose operon repressor (LacI) contains one HTH lacI-type DNA-binding domain, functions as a homotetramer. Lactose operon repressor as a repressor of the lactose operon, which also as an inducer, binds allolactose. If remove residues 1-59, resulting the loss of DNA-binding activity but retains tetrameric structure and inducer-binding activity. If delete residues 340-360, resulting the loss of tetramer formation, but retains dimer formation, inducer-binding activity, and DNA-binding activity. | 
| Form : | Supplied as a 0.2 μM filtered solution of 20mM Tris, 300mM NaCl, 5mM DTT pH 8.0 | 
| AA Sequence : | MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSLLIG VATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDD QDAIAVEAACTNVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSAR LRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITES GLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVK RKTTLAPNTQTASPRALADSLMQLARQVSRLESGQHHHHHH | 
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). | 
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | 
| Storage : | Store at < -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles. | 
| ◆ Recombinant Proteins | ||
| lacI-90E | Recombinant Escherichia coli (strain K12) lacI protein, His-tagged | +Inquiry | 
| lacI-89E | Recombinant E.coli LacI, His-tagged | +Inquiry | 
| lacI-4255E | Recombinant Escherichia coli lacI protein, His-SUMO-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All lacI Products
Required fields are marked with *
My Review for All lacI Products
Required fields are marked with *
  
        
    
      
            