Recombinant E.coli map, His-tagged map-91E

Recombinant E.coli map, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant E.coli map, His-tagged

Recombinant E.coli map, His-tagged

map Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : map-91E
Product Overview : Recombinant E. coli Methionine Aminopeptidase/MAP is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Glu264) of E.coli MAP.
Description : Methionine aminopeptidase 1, METAP, also named MAP 1, MetAP 1, Peptidase M 1, is a member of the M24 family of metalloproteases. METAPs play a central role for protein maturation as they remove the initiator Met residue from newly synthesized proteins and are essential for cell growth. Three METAP genes (METAP1, METAP2 and MAP1D) have been identified in the human genome. METAP1 and METAP2 have different substrate specificity due to the differences in both size and shape of the active sites. METAP1 plays an important role in G(2)/M phase regulation of the cell cycle and may serve as a promising target for the discovery and development of new anticancer agents. Fumagillin, a natural compound, covalently modifies an active His residue of METAP2 and prevents the vascularization and metasis of tumors.
Source : E. coli
Species : E. coli
Tag : His
Form : Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 100mM NaCl, 50% Glycerol, pH 8.0
AA Sequence : MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGY PKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQ ESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVL KPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAII SHDELEHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Store at < -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles.

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy