Recombinant E.coli metC, His-tagged
| Cat.No. : | metC-92E |
| Product Overview : | Recombinant E. coli Cystathionine Beta-Lyase MetC/metC is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Val395) of E. coli metC fused with a 6His tag at the N-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-395 a.a. |
| Description : | Cystathionine Beta-Lyase MetC (CBL) belongs to the family of Lyases, specifically the class of carbon-sulfur lyases. CBL catalyzes the chemical reaction converting L-cystathionine to L-homocysteine, NH3 and pyruvate. This reaction depends on pyridoxal phosphate as a cofactor. CBL participates in 5 metabolic pathways: methionine metabolism, cysteine metabolism, selenoamino acid metabolism, nitrogen metabolism, and sulfur metabolism. |
| Form : | Supplied as a 0.2 μM filtered solution of PBS, pH 7.4 |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMADKKLDTQLVNAGRSKKYTLGAVNSVIQRASSLVFDSVEAKKHA TRNRANGELFYGRRGTLTHFSLQQAMCELEGGAGCVLFPCGAAAVANSILAFIEQGDHVLMTNTA YEPSQDFCSKILSKLGVTTSWFDPLIGADIVKHLQPNTKIVFLESPGSITMEVHDVPAIVAAVRS VVPDAIIMIDNTWAAGVLFKALDFGIDVSIQAATKYLVGHSDAMIGTAVCNARCWEQLRENAYLM GQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGSKGHEFWKRDFT GSSGLFSFVLKKKLNNEELANYLDNFSLFSMAYSWGGYESLILANQPEHIAAIRPQGEIDFSGTL IRLHIGLEDVDDLIADLDAGFARIV |
| Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Storage : | Store at < -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles. |
| ◆ Recombinant Proteins | ||
| metC-92E | Recombinant E.coli metC, His-tagged | +Inquiry |
| metC-5287E | Recombinant Escherichia coli (strain K12) metC protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All metC Products
Required fields are marked with *
My Review for All metC Products
Required fields are marked with *
