"metC" Related Products

Recombinant E.coli metC, His-tagged

Cat.No.: metC-92E
Product Overview: Recombinant E. coli Cystathionine Beta-Lyase MetC/metC is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Val395) of E. coli metC fused with a 6His tag at the N-terminus.
Description: Cystathionine Beta-Lyase MetC (CBL) belongs to the family of Lyases, specifically the class of carbon-sulfur lyases. CBL catalyzes the chemical reaction converting L-cystathionine to L-homocysteine, NH3 and pyruvate. This reaction depends on pyridoxal phosphate as a cofactor. CBL participates in 5 metabolic pathways: methionine metabolism, cysteine metabolism, selenoamino acid metabolism, nitrogen metabolism, and sulfur metabolism.
Source: E. coli
Species: E. coli
Tag: His
Form: Supplied as a 0.2 μM filtered solution of PBS, pH 7.4
AA Sequence: MGSSHHHHHHSSGLVPRGSHMADKKLDTQLVNAGRSKKYTLGAVNSVIQRASSLVFDSVEAKKHA TRNRANGELFYGRRGTLTHFSLQQAMCELEGGAGCVLFPCGAAAVANSILAFIEQGDHVLMTNTA YEPSQDFCSKILSKLGVTTSWFDPLIGADIVKHLQPNTKIVFLESPGSITMEVHDVPAIVAAVRS VVPDAIIMIDNTWAAGVLFKALDFGIDVSIQAATKYLVGHSDAMIGTAVCNARCWEQLRENAYLM GQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGSKGHEFWKRDFT GSSGLFSFVLKKKLNNEELANYLDNFSLFSMAYSWGGYESLILANQPEHIAAIRPQGEIDFSGTL IRLHIGLEDVDDLIADLDAGFARIV
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Store at < -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles.

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.