Recombinant Human MT1E, GST-tagged

Cat.No. : MT1E-124H
Product Overview : Recombinant Human MT1E(1 a.a. - 61 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Metallothionein-1E is a protein that in humans is encoded by the MT1E gene.
Molecular Mass : 32.45 kDa
AA Sequence : MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCCA
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MT1E metallothionein 1E [ Homo sapiens (human) ]
Official Symbol MT1E
Synonyms MT1E; MT1; MTD; metallothionein 1E; metallothionein-1E; MT-1E; MT-IE; metallothionein D; metallothionein-IE; metallothionein 1E (functional)
Gene ID 4493
mRNA Refseq NM_175617
Protein Refseq NP_783316
MIM 156351
UniProt ID P04732
Chromosome Location 16q13
Pathway Mineral absorption
Function zinc ion binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MT1E Products

Required fields are marked with *

My Review for All MT1E Products

Required fields are marked with *

0
cart-icon
0
compare icon