"MT1E" Related Products

Expand
Expand

Recombinant Human MT1E, GST-tagged

Cat.No. : MT1E-124H
Product Overview : Recombinant Human MT1E(1 a.a. - 61 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description : Metallothionein-1E is a protein that in humans is encoded by the MT1E gene.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 32.45 kDa
AA Sequence : MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCCA
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : MT1E metallothionein 1E [ Homo sapiens (human) ]
Official Symbol : MT1E
Synonyms : MT1E; MT1; MTD; metallothionein 1E; metallothionein-1E; MT-1E; MT-IE; metallothionein D; metallothionein-IE; metallothionein 1E (functional)
Gene ID : 4493
mRNA Refseq : NM_175617
Protein Refseq : NP_783316
MIM : 156351
UniProt ID : P04732
Chromosome Location : 16q13
Pathway : Mineral absorption
Function : zinc ion binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.