Recombinant Human MT1E Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MT1E-661H
Product Overview : MT1E MS Standard C13 and N15-labeled recombinant protein (NP_783316) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
Molecular Mass : 6 kDa
AA Sequence : MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCCATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MT1E metallothionein 1E [ Homo sapiens (human) ]
Official Symbol MT1E
Synonyms MT1E; metallothionein 1E; MT1; MTD; MT-1E; MT-IE; metallothionein-1E; metallothionein 1E (functional); metallothionein D; metallothionein-IE
Gene ID 4493
mRNA Refseq NM_175617
Protein Refseq NP_783316
MIM 156351
UniProt ID P04732

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MT1E Products

Required fields are marked with *

My Review for All MT1E Products

Required fields are marked with *

0

Inquiry Basket

cartIcon