Recombinant Human MT1E Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | MT1E-661H |
| Product Overview : | MT1E MS Standard C13 and N15-labeled recombinant protein (NP_783316) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. |
| Molecular Mass : | 6 kDa |
| AA Sequence : | MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCCATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | MT1E metallothionein 1E [ Homo sapiens (human) ] |
| Official Symbol | MT1E |
| Synonyms | MT1E; metallothionein 1E; MT1; MTD; MT-1E; MT-IE; metallothionein-1E; metallothionein 1E (functional); metallothionein D; metallothionein-IE |
| Gene ID | 4493 |
| mRNA Refseq | NM_175617 |
| Protein Refseq | NP_783316 |
| MIM | 156351 |
| UniProt ID | P04732 |
| ◆ Recombinant Proteins | ||
| MT1E-2704R | Recombinant Rhesus Macaque MT1E Protein, His (Fc)-Avi-tagged | +Inquiry |
| MT1E-1317HFL | Recombinant Full Length Human MT1E Protein, C-Flag-tagged | +Inquiry |
| MT1E-1445H | Recombinant Human MT1E Protein, His (Fc)-Avi-tagged | +Inquiry |
| MT1E-69H | Recombinant Human MT1E protein | +Inquiry |
| MT1E-2884R | Recombinant Rhesus monkey MT1E Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MT1E Products
Required fields are marked with *
My Review for All MT1E Products
Required fields are marked with *
