Recombinant Full Length Human MT1E Protein, C-Flag-tagged
Cat.No. : | MT1E-1317HFL |
Product Overview : | Recombinant Full Length Human MT1E Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable zinc ion binding activity. Involved in cellular response to cadmium ion and cellular response to zinc ion. Located in cytoplasm and nucleus. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 5.8 kDa |
AA Sequence : | MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCCATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | MT1E metallothionein 1E [ Homo sapiens (human) ] |
Official Symbol | MT1E |
Synonyms | MT1; MTD; MT-1E; MT-IE |
Gene ID | 4493 |
mRNA Refseq | NM_175617.4 |
Protein Refseq | NP_783316.2 |
MIM | 156351 |
UniProt ID | P04732 |
◆ Recombinant Proteins | ||
MT1E-661H | Recombinant Human MT1E Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MT1E-2704R | Recombinant Rhesus Macaque MT1E Protein, His (Fc)-Avi-tagged | +Inquiry |
MT1E-124H | Recombinant Human MT1E, GST-tagged | +Inquiry |
MT1E-6988HF | Recombinant Full Length Human MT1E Protein, GST-tagged | +Inquiry |
MT1E-2884R | Recombinant Rhesus monkey MT1E Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MT1E Products
Required fields are marked with *
My Review for All MT1E Products
Required fields are marked with *