Recombinant Full Length Human MT1E Protein, C-Flag-tagged

Cat.No. : MT1E-1317HFL
Product Overview : Recombinant Full Length Human MT1E Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Predicted to enable zinc ion binding activity. Involved in cellular response to cadmium ion and cellular response to zinc ion. Located in cytoplasm and nucleus.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 5.8 kDa
AA Sequence : MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCCATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome
Full Length : Full L.
Gene Name MT1E metallothionein 1E [ Homo sapiens (human) ]
Official Symbol MT1E
Synonyms MT1; MTD; MT-1E; MT-IE
Gene ID 4493
mRNA Refseq NM_175617.4
Protein Refseq NP_783316.2
MIM 156351
UniProt ID P04732

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MT1E Products

Required fields are marked with *

My Review for All MT1E Products

Required fields are marked with *

0
cart-icon
0
compare icon