Recombinant Full Length Human MT1E Protein, C-Flag-tagged
| Cat.No. : | MT1E-1317HFL |
| Product Overview : | Recombinant Full Length Human MT1E Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Predicted to enable zinc ion binding activity. Involved in cellular response to cadmium ion and cellular response to zinc ion. Located in cytoplasm and nucleus. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 5.8 kDa |
| AA Sequence : | MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCCATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome |
| Full Length : | Full L. |
| Gene Name | MT1E metallothionein 1E [ Homo sapiens (human) ] |
| Official Symbol | MT1E |
| Synonyms | MT1; MTD; MT-1E; MT-IE |
| Gene ID | 4493 |
| mRNA Refseq | NM_175617.4 |
| Protein Refseq | NP_783316.2 |
| MIM | 156351 |
| UniProt ID | P04732 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MT1E Products
Required fields are marked with *
My Review for All MT1E Products
Required fields are marked with *
