Recombinant Full Length Human MT1E Protein, C-Flag-tagged

• Cat.No.: MT1E-1317HFL
• Product Overview: Recombinant Full Length Human MT1E Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Predicted to enable zinc ion binding activity. Involved in cellular response to cadmium ion and cellular response to zinc ion. Located in cytoplasm and nucleus.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 5.8 kDa
• AA Sequence: MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCCATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome
• Full Length: Full L.

Gene Information

• Gene Name: MT1E metallothionein 1E [ Homo sapiens (human) ]
• Official Symbol: MT1E
• Synonyms: MT1; MTD; MT-1E; MT-IE
• Gene ID: 4493
• mRNA Refseq: NM_175617.4
• Protein Refseq: NP_783316.2
• MIM: 156351
• UniProt ID: P04732