"MT1F" Related Products

Expand

Recombinant Human MT1F, GST-tagged

Cat.No.: MT1F-125H
Product Overview: Recombinant Human MT1F(1 a.a. - 61 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: Metallothionein-1F is a protein that in humans is encoded by the MT1F gene.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 32.45 kDa
AA Sequence: MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCCD
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: MT1F metallothionein 1F [ Homo sapiens (human) ]
Official Symbol: MT1F
Synonyms: MT1F; MT1; metallothionein 1F; metallothionein-1F; MT-1F; MT-IF; metallothionein-IF; metallothionein 1F (functional)
Gene ID: 4494
mRNA Refseq: NM_001301272
Protein Refseq: NP_001288201
MIM: 156352
UniProt ID: P04733
Chromosome Location: 16q13
Pathway: Mineral absorption
Function: zinc ion binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.