"MT3" Related Products

Expand
Expand
Expand

Recombinant Human MT3, GST-tagged

Cat.No.: MT3-131H
Product Overview: Recombinant Human MT3(1 a.a. - 68 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: Metallothionein-3 is a protein that in humans is encoded by the MT3 gene.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 33.11 kDa
AA Sequence: MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: MT3 metallothionein 3 [ Homo sapiens (human) ]
Official Symbol: MT3
Synonyms: MT3; metallothionein 3; metallothionein 3 (growth inhibitory factor (neurotrophic)); metallothionein-3; GIF; MT-3; MT-III; metallothionein-III; growth inhibitory factor; GIFB; GRIF; ZnMT3
Gene ID: 4504
mRNA Refseq: NM_005954
Protein Refseq: NP_005945
MIM: 139255
UniProt ID: P25713
Chromosome Location: 16q13
Function: antioxidant activity; cadmium ion binding; copper ion binding; copper ion binding; cysteine-type endopeptidase inhibitor activity involved in apoptotic process; drug binding; metal ion binding; protein binding; protein kinase activator activity; zinc ion binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.