"MYH9" Related Products

Expand

Recombinant Human MYH9, GST-tagged

Cat.No.: MYH9-29H
Product Overview: Recombinant Human MYH9(131 a.a. - 220 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This gene encodes a conventional non-muscle myosin; this protein should not be confused with the unconventional myosin-9a or 9b (MYO9A or MYO9B). The encoded protein is a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain which is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in this gene have been associated with non-syndromic sensorineural deafness autosomal dominant type 17, Epstein syndrome, Alport syndrome with macrothrombocytopenia, Sebastian syndrome, Fechtner syndrome and macrothrombocytopenia with progressive sensorineural deafness.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 35.64 kDa
AA Sequence: RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDE EVDGKADGAEAKPAE
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: MYH9 myosin, heavy chain 9, non-muscle [ Homo sapiens (human) ]
Official Symbol: MYH9
Synonyms: MYH9; myosin, heavy chain 9, non-muscle; DFNA17, myosin, heavy polypeptide 9, non muscle; myosin-9; EPSTS; FTNS; MHA; NMHC II A; NMMHCA; nonmuscle myosin heavy chain II A
Gene ID: 4627
mRNA Refseq: NM_002473
Protein Refseq: NP_002464
MIM: 160775
UniProt ID: P35579
Chromosome Location: 22q13.1
Pathway: Axon guidance; Developmental Biology; EPHA-mediated growth cone collapse; Regulation of actin cytoskeleton
Function: ADP binding; contributes_to actin filament binding; contributes_to actin-dependent ATPase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.