Recombinant Human MYH9, GST-tagged
Cat.No. : | MYH9-29H |
Product Overview : | Recombinant Human MYH9(131 a.a. - 220 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a conventional non-muscle myosin; this protein should not be confused with the unconventional myosin-9a or 9b (MYO9A or MYO9B). The encoded protein is a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain which is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in this gene have been associated with non-syndromic sensorineural deafness autosomal dominant type 17, Epstein syndrome, Alport syndrome with macrothrombocytopenia, Sebastian syndrome, Fechtner syndrome and macrothrombocytopenia with progressive sensorineural deafness. |
Molecular Mass : | 35.64 kDa |
AA Sequence : | RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDE EVDGKADGAEAKPAE |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYH9 myosin, heavy chain 9, non-muscle [ Homo sapiens (human) ] |
Official Symbol | MYH9 |
Synonyms | MYH9; myosin, heavy chain 9, non-muscle; DFNA17, myosin, heavy polypeptide 9, non muscle; myosin-9; EPSTS; FTNS; MHA; NMHC II A; NMMHCA; nonmuscle myosin heavy chain II A |
Gene ID | 4627 |
mRNA Refseq | NM_002473 |
Protein Refseq | NP_002464 |
MIM | 160775 |
UniProt ID | P35579 |
Chromosome Location | 22q13.1 |
Pathway | Axon guidance; Developmental Biology; EPHA-mediated growth cone collapse; Regulation of actin cytoskeleton |
Function | ADP binding; contributes_to actin filament binding; contributes_to actin-dependent ATPase activity |
◆ Recombinant Proteins | ||
MYH9-29659TH | Recombinant Human MYH9, His-tagged | +Inquiry |
MYH9-3509R | Recombinant Rat MYH9 Protein, His (Fc)-Avi-tagged | +Inquiry |
MYH9-10309M | Recombinant Mouse MYH9 Protein | +Inquiry |
MYH9-5842M | Recombinant Mouse MYH9 Protein, His (Fc)-Avi-tagged | +Inquiry |
MYH9-4644H | Recombinant Human MYH9 Protein (Glu1740-Glu1960), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYH9 Products
Required fields are marked with *
My Review for All MYH9 Products
Required fields are marked with *