Recombinant Human MYH9, GST-tagged
| Cat.No. : | MYH9-29H | 
| Product Overview : | Recombinant Human MYH9(131 a.a. - 220 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | This gene encodes a conventional non-muscle myosin; this protein should not be confused with the unconventional myosin-9a or 9b (MYO9A or MYO9B). The encoded protein is a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain which is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in this gene have been associated with non-syndromic sensorineural deafness autosomal dominant type 17, Epstein syndrome, Alport syndrome with macrothrombocytopenia, Sebastian syndrome, Fechtner syndrome and macrothrombocytopenia with progressive sensorineural deafness. | 
| Molecular Mass : | 35.64 kDa | 
| AA Sequence : | RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDE EVDGKADGAEAKPAE | 
| Applications : | ELISA; WB-Re; AP; Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | MYH9 myosin, heavy chain 9, non-muscle [ Homo sapiens (human) ] | 
| Official Symbol | MYH9 | 
| Synonyms | MYH9; myosin, heavy chain 9, non-muscle; DFNA17, myosin, heavy polypeptide 9, non muscle; myosin-9; EPSTS; FTNS; MHA; NMHC II A; NMMHCA; nonmuscle myosin heavy chain II A | 
| Gene ID | 4627 | 
| mRNA Refseq | NM_002473 | 
| Protein Refseq | NP_002464 | 
| MIM | 160775 | 
| UniProt ID | P35579 | 
| Chromosome Location | 22q13.1 | 
| Pathway | Axon guidance; Developmental Biology; EPHA-mediated growth cone collapse; Regulation of actin cytoskeleton | 
| Function | ADP binding; contributes_to actin filament binding; contributes_to actin-dependent ATPase activity | 
| ◆ Recombinant Proteins | ||
| MYH9-3850R | Recombinant Rat MYH9 Protein | +Inquiry | 
| MYH9-7026C | Recombinant Chicken MYH9 | +Inquiry | 
| MYH9-29659TH | Recombinant Human MYH9, His-tagged | +Inquiry | 
| Myh9-5950R | Recombinant Rat Myh9 protein, His&Myc-tagged | +Inquiry | 
| MYH9-10309M | Recombinant Mouse MYH9 Protein | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYH9 Products
Required fields are marked with *
My Review for All MYH9 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            