Recombinant Human MSTN, GST-tagged MSTN-121H

Recombinant Human MSTN, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human MSTN, GST-tagged

Recombinant Human MSTN, GST-tagged

MSTN Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : MSTN-121H
Product Overview : Recombinant Human MSTN(121 a.a. - 202 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description : The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. This gene is thought to encode a secreted protein which negatively regulates skeletal muscle growth.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 34.63 kDa
AA Sequence : MPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLD MNPGTGI
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : MSTN myostatin [ Homo sapiens (human) ]
Official Symbol : MSTN
Synonyms : MSTN; myostatin; GDF8; MSLHP; growth/differentiation factor 8; GDF-8; growth differentiation factor 8
Gene ID : 2660
mRNA Refseq : NM_005259
Protein Refseq : NP_005250
MIM : 601788
UniProt ID : O14793
Chromosome Location : 2q32.2
Pathway : Hypertrophy Model
Function : cytokine activity; growth factor ; heparin binding; identical protein binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy