Active Recombinant Human MSTN Protein

Cat.No. : MSTN-211H
Product Overview : Recombinant Human MSTN Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 267-375
Description : Myostatin, also known as GDF-8, is a conserved member of the TGF-beta superfamily. Myostatin is an essential regulator of skeletal muscle mass and cardiac muscle development and function. Myostatin is a secreted protein that negatively regulates skeletal muscle growth by determining muscle fiber number and size. Myostatin binds one of the two activin type II receptors (ACTRIIA or ACTRIIB) to activate SMAD signaling. Myostatin also activates MAPK signaling through TAK1-MKK6 and Ras pathways. Inhibition of myostatin increases muscle mass in a number of human disease animal models, such as muscular dystrophy.
Bio-activity : MPC-11 cell cytotoxicity, ≤50 ng/ml; ≥2.0 x 10^4 units/mg
Molecular Mass : Dimer, 12.4/24.8 kDa (109/218 aa)
AA Sequence : DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile 20 mM HCl at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name MSTN myostatin [ Homo sapiens (human) ]
Official Symbol MSTN
Synonyms MSTN; myostatin; GDF8, growth differentiation factor 8; growth/differentiation factor 8; GDF-8; growth differentiation factor 8; GDF8; MSLHP;
Gene ID 2660
mRNA Refseq NM_005259
Protein Refseq NP_005250
MIM 601788
UniProt ID O14793

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MSTN Products

Required fields are marked with *

My Review for All MSTN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon