"GPAM" Related Products

Expand
Expand
Expand

Recombinant Human GPAM, GST-tagged

Cat.No.: GPAM-137H
Product Overview: Recombinant Human GPAM(1 a.a. - 828 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This gene encodes a mitochondrial enzyme which prefers saturated fatty acids as its substrate for the synthesis of glycerolipids. This metabolic pathway's first step is catalyzed by the encoded enzyme. Two forms for this enzyme exist, one in the mitochondria and one in the endoplasmic reticulum. Two alternatively spliced transcript variants have been described for this gene.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 120.3 kDa
AA Sequence: MDEYALTLGTIDVSYLPHSSEYSVGRCKHTSEEWGECGFRPTIFRSATLKWKESLMSRKRPFVGRCCYSCTPQSW DKFFNTSIPSLGLRNVIYINETHTRHRGWLARRLSYVLFIQERDVHKGMFATNVTENVLNSSRVQEAIAEVAAEL NPDGSAQQQSKAVNKVKKKAKRILQEMVATVSPAMIRLTGWVLLKLFNSFFWNIQIHKGQLEMVKAATETNLPLL FLPVHRSHIDYLLLTFILFCHNIKAPYIASGNNLNIPIFSTLIHKLGGFFIRRRLDETPDGRKDVLYRALLHGHI VELLRQQQFLEIFLEGTRSRSGKTSCARAGLLSVVVDTLSTNVIPDILIIPVGISYDRIIEGHYNGEQLGKPKKN ESLWSVARGVIRMLRKNYGCVRVDFAQPFSLKEYLESQSQKPVSALLSLEQALLPAILPSRPSDAADEGRDTSIN ESRNATDESLRRRLIANLAEHILFTASKSCAIMSTHIVACLLLYRHRQGIDLSTLVEDFFVMKEEVLARDFDLGF SGNSEDVVMHAIQLLGNCVTITHTSRNDEFFITPSTTVPSVFELNFYSNGVLHVFIMEAIIACSLYAVLNKRGLG GPTSTPPNLISQEQLVRKAASLCYLLSNEGTISLPCQTFYQVCHETVGKFIQYGILTVAEHDDQEDISPSLAEQQ WDKKLPEPLSWRSDEEDEDSDFGEEQRDCYLKVSQSKEHQQFITFLQRLLGPLLEAYSSAAIFVHNFSGPVPEPE YLQKLHKYLITRTERNVAVYAESATYCLVKNAVKMFKDIGVFKETKQKRVSVLELSSTFLPQCNRQKLLEYILSF VVL
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: GPAM glycerol-3-phosphate acyltransferase, mitochondrial [ Homo sapiens (human) ]
Official Symbol: GPAM
Synonyms: GPAM; glycerol-3-phosphate acyltransferase, mitochondrial; glycerol-3-phosphate acyltransferase 1, mitochondrial; glycerol 3 phosphate acyltransferase 1; mitochondrial; GPAT1; KIAA1560; MGC26846; GPAT-1; glycerol 3-phosphate acyltransferase, mitochondrial; GPAT; RP11-426E5.2
Gene ID: 57678
mRNA Refseq: NM_001244949
Protein Refseq: NP_001231878
MIM: 602395
UniProt ID: Q9HCL2
Chromosome Location: 10q25.2
Pathway: Activation of gene expression by SREBF (SREBP); CDP-diacylglycerol biosynthesis; Glycerolipid metabolism
Function: glycerol-3-phosphate O-acyltransferase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.