Native E. coli L-asparagine amidohydrolase therapeutic protein L-asparagine amidohydrolase-P009E

Native E. coli L-asparagine amidohydrolase therapeutic protein

PRODUCTS

Home / Products / Native E. coli L-asparagine amidohydrolase therapeutic protein

Native E. coli L-asparagine amidohydrolase therapeutic protein

L-asparagine amidohydrolase Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : L-asparagine amidohydrolase-P009E
Product Overview : L-asparagine amidohydrolase from E. coli
Description : L-asparagine amidohydrolase played an important role in many functions.
Species : E. coli
Molecular Mass : 31.7 Kda
Protein length : 303aa
AA Sequence : QMSLQQELRYIEALSAIVETGQKMLEAGESALDVVTEAVRLLEECPLFNAGIGAVFTRDETHELDACVMDG NTLKAGAVAGVSHLRNPVLAARLVMEQSPHVMMIGEGAENFAFARGMERVSPEIFSTSLRYEQLLAARKEG ATVLDHSGAPLDEKQKMGTVGAVALDLDGNLAAATSTGGMTNKLPGRVGDSPLVGAGCYANNASVAVSCTG TGEVFIRALAAYDIAALMDYGGLSLAEACERVVMEKLPTLGGSGGLIAIDHEGNVALPFNTEGMYRAWGYA GDTPTTGIYREKGDTVATQ
Endotoxin : < 1.0 EU per μg of the protein
Purity : >95%
Storage : Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy