"L-asparagine amidohydrolase" Related Products

Native E. coli L-asparagine amidohydrolase therapeutic protein

Cat.No.: L-asparagine amidohydrolase-P009E
Product Overview: L-asparagine amidohydrolase from E. coli
Description: L-asparagine amidohydrolase played an important role in many functions.
Species: E. coli
Molecular Mass: 31.7 Kda
Protein length: 303aa
AA Sequence: QMSLQQELRYIEALSAIVETGQKMLEAGESALDVVTEAVRLLEECPLFNAGIGAVFTRDETHELDACVMDG NTLKAGAVAGVSHLRNPVLAARLVMEQSPHVMMIGEGAENFAFARGMERVSPEIFSTSLRYEQLLAARKEG ATVLDHSGAPLDEKQKMGTVGAVALDLDGNLAAATSTGGMTNKLPGRVGDSPLVGAGCYANNASVAVSCTG TGEVFIRALAAYDIAALMDYGGLSLAEACERVVMEKLPTLGGSGGLIAIDHEGNVALPFNTEGMYRAWGYA GDTPTTGIYREKGDTVATQ
Endotoxin: < 1.0 EU per μg of the protein
Purity: >95%
Storage: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
Products Types

Related Gene

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.