"L-asparagine amidohydrolase" Related Products

      Native E. coli L-asparagine amidohydrolase therapeutic protein

      Cat.No. : L-asparagine amidohydrolase-P009E
      Product Overview : L-asparagine amidohydrolase from E. coli
      Description : L-asparagine amidohydrolase played an important role in many functions.
      Species : E. coli
      Molecular Mass : 31.7 Kda
      Protein length : 303aa
      AA Sequence : QMSLQQELRYIEALSAIVETGQKMLEAGESALDVVTEAVRLLEECPLFNAGIGAVFTRDETHELDACVMDG NTLKAGAVAGVSHLRNPVLAARLVMEQSPHVMMIGEGAENFAFARGMERVSPEIFSTSLRYEQLLAARKEG ATVLDHSGAPLDEKQKMGTVGAVALDLDGNLAAATSTGGMTNKLPGRVGDSPLVGAGCYANNASVAVSCTG TGEVFIRALAAYDIAALMDYGGLSLAEACERVVMEKLPTLGGSGGLIAIDHEGNVALPFNTEGMYRAWGYA GDTPTTGIYREKGDTVATQ
      Endotoxin : < 1.0 EU per μg of the protein
      Purity : >95%
      Storage : Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.

      Online Inquiry

      Note: There will be extra charge for optional service!

      Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

      Optional requirements on this protein    +Expand

      Price Inquiry

      Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.