Recombinant Human INS therapeutic protein

• Cat.No.: INS-P040H
• Product Overview: Recombinant Human INS therapeutic protein was expressed in E. coli.

Specification

• Description: The expression product is the active ingredient of Novolin R.
• Source: E. coli
• Species: Human
• Molecular Mass: 5.8 kDa
• Protein length: 30 aa
• AA Sequence: FVNQHLCGSHLVEALYLVCGERGFFYTPKT
• Endotoxin: < 1.0 EU per μg of the protein
• Purity: >95%
• Storage: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.

Gene Information

• Gene Name: INS insulin [ Homo sapiens ]
• Official Symbol: INS
• Synonyms: INS; insulin; proinsulin; ILPR; IRDN; IDDM2; MODY10
• Gene ID: 3630
• mRNA Refseq: NM_000207
• Protein Refseq: NP_000198
• UniProt ID: P01308
• Chromosome Location: 11p15.5
• Pathway: ATF-2 transcription factor network, organism-specific biosystem; Adipogenesis, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Amyloids, organism-specific biosystem; Arf6 trafficking events, organism-specific biosystem; Developmental Biology, organism-specific biosystem
• Function: hormone activity; hormone activity; hormone activity; insulin receptor binding; insulin receptor binding; insulin-like growth factor receptor binding; protein binding