"EPO" Related Products

Expand
Expand

Recombinant Human EPO therapeutic protein

Cat.No.: EPO-P011H
Product Overview: Human erythropoietin (recombinant), produced by CHO cells.
Description: This gene is a member of the EPO/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types.The expression product is the active ingredient of Epogen, Epogin, Epomax, Eprex, NeoRecormon, Procrit, Recormon, Dynepo and Procrit.
Source: CHO
Species: Human
Molecular Mass: 18.4 Kda
Protein length: 166 Aa
AA Sequence: APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLS EAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLF RVYSNFLRGKLKLYTGEACRTGDR
Endotoxin: < 0.1 EU per μg of the protein
Purity: >95%
Storage: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
Gene Name: EPO erythropoietin [ Homo sapiens ]
Official Symbol: EPO
Synonyms: EPO; erythropoietin; EP; epoetin; MVCD2; MGC138142;
Gene ID: 2056
mRNA Refseq: NM_000799
Protein Refseq: NP_000790
MIM: 133170
UniProt ID: P01588
Chromosome Location: 7q21
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; EPO Receptor Signaling, organism-specific biosystem; EPO signaling pathway, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem; HIF-2-alpha transcription factor network, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem;
Function: erythropoietin receptor binding; eukaryotic cell surface binding; hormone activity; protein binding; protein kinase activator activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.