Recombinant Human CSF3 therapeutic protein(Lenograstim)
| Cat.No. : | CSF3-P054H |
| Product Overview : | Recombinant Human CSF3 therapeutic protein was expressed in E. coli. |
| Availability | December 18, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 175aa |
| Description : | The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes. The active protein is found extracellularly. Alternatively spliced transcript variants have been described for this gene. The expression product is the active ingredient of Neupogen, Granulokine and Granocyte. |
| Molecular Mass : | 18.9 Kda |
| AA Sequence : | MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQ LAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFA SAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
| Endotoxin : | < 1.0 EU per μg of the protein |
| Purity : | >95% |
| Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
| Alias : | CSF3; GCSF; CSF3OS; Lenograstim |
| Gene Name | CSF3 colony stimulating factor 3 (granulocyte) [ Homo sapiens ] |
| Official Symbol | CSF3 |
| Synonyms | CSF3; colony stimulating factor 3 (granulocyte); C17orf33, chromosome 17 open reading frame 33 , G CSF, GCSF; granulocyte colony-stimulating factor; filgrastim; granulocyte colony stimulating factor; lenograstim; MGC45931; pluripoietin; GCSF; CSF3OS; C17orf33; |
| Gene ID | 1440 |
| mRNA Refseq | NM_000759 |
| Protein Refseq | NP_000750 |
| MIM | 138970 |
| UniProt ID | P09919 |
| Chromosome Location | 17q11.2-q12 |
| Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; |
| Function | cytokine activity; cytokine activity; enzyme binding; granulocyte colony-stimulating factor receptor binding; growth factor activity; |
| ◆ Recombinant Proteins | ||
| Csf3-395C | Active Recombinant Rat Csf3 Protein (194 aa) | +Inquiry |
| CSF3-2170HF | Recombinant Full Length Human CSF3 Protein, GST-tagged | +Inquiry |
| Csf3-2163R | Active Recombinant Rat Csf3 protein, His-tagged | +Inquiry |
| CSF3-024E | Active Recombinant Human CSF3 (27 - 200aa), Met tagged | +Inquiry |
| CSF3-178M | Active Recombinant Mouse CSF3, MIgG2a Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CSF3-2948HCL | Recombinant Human CSF3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSF3 Products
Required fields are marked with *
My Review for All CSF3 Products
Required fields are marked with *
