Recombinant Human LDHC, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human LDHC, GST-tagged

Recombinant Human LDHC, GST-tagged

LDHC Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : LDHC-258H
Product Overview : Recombinant Human LDHC(1 a.a. - 332 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description : Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5' untranslated region.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 62.7 kDa
AA Sequence : MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTS KITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKI SGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKE HWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGV SDVVKINLNSEEEALFKKSAETLWNIQKDLIF
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : LDHC lactate dehydrogenase C [ Homo sapiens (human) ]
Official Symbol : LDHC
Synonyms : LDHC; lactate dehydrogenase C; CT32; LDH3; LDHX; L-lactate dehydrogenase C chain; LDH testis subunit; LDH-C; LDH-X; cancer/testis antigen 32; lactate dehydrogenase C4; lactate dehydrogenase c variant 1; lactate dehydrogenase c variant 3; lactate dehydrogenase c variant 4; NP_002292.1; EC 1.1.1.27; NP_059144.1
Gene ID : 3948
mRNA Refseq : NM_002301
Protein Refseq : NP_002292
MIM : 150150
UniProt ID : P07864
Chromosome Location : 11p15.1
Pathway : Cysteine and methionine metabolism; Glycolysis / Gluconeogenesis; Propanoate metabolism
Function : L-lactate dehydrogenase activity

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.