"CYP17A1" Related Products

Expand
Expand
Expand

Recombinant Human Cytochrome P450 17A1

Cat.No.: CYP17A1-01H
Source: E.coli
Species: Human
Form: 50mM Tris- HCl, pH7.4, 200mM NaCl, 10% glycerol
Molecular Mass: Theoretical MW: ~55kDa
AA Sequence: AKKTGAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFS GRPQMATLDIASNNRKGIAFADSGAHWQLHRRLAMATFALFKDGDQKLEKIICQEISTLCDMLATHNGQSIDISF PVFVAVTNVISLICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLN KILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLL HNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVII NLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPD DGQLPSLEGIPKVVFLIDSFKVKIKVRQAWREAQAEGST
Purity: >90% determined by SDS-PAGE.
Storage: Short Term Storage +4°C. Long Term Storage -20°C please prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.
Gene Name: CYP17A1 cytochrome P450, family 17, subfamily A, polypeptide 1 [ Homo sapiens ]
Official Symbol: CYP17A1
Synonyms: CYP17A1; cytochrome P450, family 17, subfamily A, polypeptide 1; CYP17, cytochrome P450, subfamily XVII (steroid 17 alpha hydroxylase), adrenal hyperplasia; steroid 17-alpha-hydroxylase/17,20 lyase; CPT7; P450C17; S17AH; Steroid 17 alpha monooxygenase; CYPXVII; cytochrome P450c17; cytochrome P450-C17; cytochrome P450 17A1; cytochrome p450 XVIIA1; steroid 17-alpha-monooxygenase; cytochrome P450, subfamily XVII (steroid 17-alpha-hydroxylase), adrenal hyperplasia; CYP17;
Gene ID: 1586
mRNA Refseq: NM_000102
Protein Refseq: NP_000093
MIM: 609300
UniProt ID: P05093
Chromosome Location: 10q24.3
Pathway: Androgen biosynthesis, organism-specific biosystem; Biological oxidations, organism-specific biosystem; C19/C18-Steroid hormone biosynthesis, pregnenolone =>androstenedione => estrone, organism-specific biosystem; C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione =>
Function: electron carrier activity; heme binding; metal ion binding; monooxygenase activity; oxygen binding; steroid 17-alpha-monooxygenase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.