Recombinant Human Cytochrome P450 17A1 CYP17A1-01H

Recombinant Human Cytochrome P450 17A1

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human Cytochrome P450 17A1

Recombinant Human Cytochrome P450 17A1

CYP17A1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CYP17A1-01H
Source : E.coli
Species : Human
Form : 50mM Tris- HCl, pH7.4, 200mM NaCl, 10% glycerol
Molecular Mass : Theoretical MW: ~55kDa
AA Sequence : AKKTGAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFS GRPQMATLDIASNNRKGIAFADSGAHWQLHRRLAMATFALFKDGDQKLEKIICQEISTLCDMLATHNGQSIDISF PVFVAVTNVISLICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLN KILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLL HNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVII NLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPD DGQLPSLEGIPKVVFLIDSFKVKIKVRQAWREAQAEGST
Purity : >90% determined by SDS-PAGE.
Storage : Short Term Storage +4°C. Long Term Storage -20°C please prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.
Gene Name : CYP17A1 cytochrome P450, family 17, subfamily A, polypeptide 1 [ Homo sapiens ]
Official Symbol : CYP17A1
Synonyms : CYP17A1; cytochrome P450, family 17, subfamily A, polypeptide 1; CYP17, cytochrome P450, subfamily XVII (steroid 17 alpha hydroxylase), adrenal hyperplasia; steroid 17-alpha-hydroxylase/17,20 lyase; CPT7; P450C17; S17AH; Steroid 17 alpha monooxygenase; CYPXVII; cytochrome P450c17; cytochrome P450-C17; cytochrome P450 17A1; cytochrome p450 XVIIA1; steroid 17-alpha-monooxygenase; cytochrome P450, subfamily XVII (steroid 17-alpha-hydroxylase), adrenal hyperplasia; CYP17;
Gene ID : 1586
mRNA Refseq : NM_000102
Protein Refseq : NP_000093
MIM : 609300
UniProt ID : P05093
Chromosome Location : 10q24.3
Pathway : Androgen biosynthesis, organism-specific biosystem; Biological oxidations, organism-specific biosystem; C19/C18-Steroid hormone biosynthesis, pregnenolone =>androstenedione => estrone, organism-specific biosystem; C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione =>
Function : electron carrier activity; heme binding; metal ion binding; monooxygenase activity; oxygen binding; steroid 17-alpha-monooxygenase activity;

Products Types

◆ Recombinant Protein

CYP17A1-2241HRecombinant Human CYP17A1 Protein, GST-tagged+Inquiry
CYP17A1-02HRecombinant Human CYP17A1 Protein+Inquiry
CYP17A1-1135RRecombinant Rhesus monkey CYP17A1 Protein, His-tagged+Inquiry
CYP17A1-11763HRecombinant Human CYP17A1, GST-tagged+Inquiry
CYP17A1-4147MRecombinant Mouse CYP17A1 Protein+Inquiry

See All CYP17A1 Recombinant Protein

◆ Lysates

CYP17A1-7128HCLRecombinant Human CYP17A1 293 Cell Lysate+Inquiry

See All CYP17A1 Lysates

Related Gene

CYP2C19CYP2C9CYP2D6CYP2E1CYP3A4CYP1B1CYP24A1CYP2J2CYP46A1CYP7B1CYP1A2CYP19A1CYP26A1CYP26B1CYP2A6CYP3A5CYP3A7CYP4F11CYP4F3CYP7A1CYP2C6CYP3A23/3A1CYP1A1CYP2B6CYP4A11Cyp11a1CYP2C8CYP2D4CYP3A2CYP2C18CYP3A43CYP4B1CYP2U1CYP2W1CYP39A1CYP2D1CYP2R1CYP26C1CYP27A1CYP2S1CYP2C11CYP4V2CYP4X1CYP4Z1CYP11B1CYP19A1BCYP4F12CYP4F2CYP4F22CYP38CYP27B1CYP27C1CYP2A13CYP2A7CYP20A1CYP21A2CYP4F8CYP17A1CYP2C23CYP4A22CYP4F13Cyp2a1Cyp2a12Cyp2b3Cyp2b9Cyp2c12Cyp2c13Cyp2c22Cyp2c29Cyp2c38Cyp2c39Cyp2c40Cyp2c44Cyp2c50Cyp2c54Cyp2d11Cyp2d12Cyp2d2Cyp2d22Cyp2d26Cyp2d3Cyp2d34Cyp2d40Cyp2d5Cyp2d9Cyp2f2Cyp2f4Cyp2g1Cyp2c37Cyp21a1Cyp3a11Cyp3a13Cyp3a16Cyp3a18Cyp3a25Cyp3a41aCyp3a41bCyp3a57Cyp4a31Cyp4a32Cyp4a8Cyp4f1Cyp4f14Cyp4f15Cyp4f17Cyp4f18Cyp4f6Cyp4v3Cyp51CYP8B1Cyp11b2Cyp11b3Cyp2a2Cyp2a22Cyp2a3Cyp2a4Cyp2a5Cyp2ab1Cyp2b1Cyp2b10Cyp2b12Cyp2b13Cyp2b15Cyp2b19Cyp2b21Cyp2b23Cyp2c6v1Cyp2c65Cyp2c66Cyp2c67Cyp2c68Cyp2c69Cyp2c7CYP2F1Cyp2j10Cyp2j12Cyp2j13Cyp2j4Cyp2j8Cyp2j9Cyp2t1Cyp2t4Cyp3a23Cyp3a44Cyp3a62Cyp3a9Cyp4a1Cyp4a12aCyp4a12bCyp4a14Cyp4a2Cyp4a29Cyp4a3Cyp4a30bCyp4f39Cyp4f4Cyp4f40Cyp4f5CYP51A1Cyp3a59CYP1B1-AS1CYP2B7P1

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy