Recombinant E. coli peptide deformylase def-01E

Recombinant E. coli peptide deformylase

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant E. coli peptide deformylase

Recombinant E. coli peptide deformylase

def Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : def-01E
Source : E.coli
Species : E.coli
Form : 20 mM Tris-HCl, 200 mM NaCl, pH7.4, 5% Trehalose
Molecular Mass : Theoretical Mol Wt: ~20 kDa
AA Sequence : MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLIN PELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPL KQQRIRQKVEKLDRLKARA
Purity : >95% as determined by SDS-PAGE
Storage : Short Term Storage at +4°C, Long Term Storage at -20°C to -80°C. Avoid freeze/thaw cycles.
Reconstitution : It is recommended to reconstitute the lyophilized PDF in sterile and pre-cooled ddH2O not less than 0.1mg/ml, which can then be further diluted to other aqueous solutions.

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy