"def" Related Products

Recombinant E. coli peptide deformylase

Cat.No.: def-01E
Source: E.coli
Species: E.coli
Form: 20 mM Tris-HCl, 200 mM NaCl, pH7.4, 5% Trehalose
Molecular Mass: Theoretical Mol Wt: ~20 kDa
AA Sequence: MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLIN PELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPL KQQRIRQKVEKLDRLKARA
Purity: >95% as determined by SDS-PAGE
Storage: Short Term Storage at +4°C, Long Term Storage at -20°C to -80°C. Avoid freeze/thaw cycles.
Reconstitution: It is recommended to reconstitute the lyophilized PDF in sterile and pre-cooled ddH2O not less than 0.1mg/ml, which can then be further diluted to other aqueous solutions.

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.