Recombinant E. coli peptide deformylase
Cat.No. : | def-01E |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | Non |
Form : | 20 mM Tris-HCl, 200 mM NaCl, pH7.4, 5% Trehalose |
Molecular Mass : | Theoretical Mol Wt: ~20 kDa |
AA Sequence : | MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLIN PELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPL KQQRIRQKVEKLDRLKARA |
Purity : | >95% as determined by SDS-PAGE |
Storage : | Short Term Storage at +4°C, Long Term Storage at -20°C to -80°C. Avoid freeze/thaw cycles. |
Reconstitution : | It is recommended to reconstitute the lyophilized PDF in sterile and pre-cooled ddH2O not less than 0.1mg/ml, which can then be further diluted to other aqueous solutions. |
◆ Recombinant Proteins | ||
DEF-1379S | Recombinant Streptomyces coelicolor A3(2) DEF protein, His-tagged | +Inquiry |
DEF-0983B | Recombinant Bacillus subtilis DEF protein, His-tagged | +Inquiry |
DEF-2966S | Recombinant Staphylococcus epidermidis ATCC 12228 DEF protein, His-tagged | +Inquiry |
def-01E | Recombinant E. coli peptide deformylase | +Inquiry |
def-5493S | Recombinant Staph def protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
DEF-196H | Native Human Defensins | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All def Products
Required fields are marked with *
My Review for All def Products
Required fields are marked with *
0
Inquiry Basket