Recombinant HIV-1 Reverse Transcriptase, His-tagged HIV1 reversetranscriptase-01V

Recombinant HIV-1 Reverse Transcriptase, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant HIV-1 Reverse Transcriptase, His-tagged

Recombinant HIV-1 Reverse Transcriptase, His-tagged

HIV-1 Reverse Transcriptase Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : HIV1 reversetranscriptase-01V
Product Overview : HIV-1 reverse transcriptase is an RNA-dependent DNA polymerase of HIV-1 virus, subtype B origin. It also has RNaseH activity and is an enzyme indispensable to the reproduction of AIDS virus. The product is uniquely over-expressed as a recombinant protein in E. coli. It is composed of two subunits (molecular weight of 35kD and 70 kD).
Source : E.coli
Species : Human immunodeficiency virus 1
Tag : His
Form : 20 mM Tris-HCl, 200 mM NaCl, pH7.4
Molecular Mass : ~35 kDa and ~70 kDa
AA Sequence : PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEEEGKISRIGPENPYNTPVFAIKKKDSTKWRKLV DFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGTRYQYNVLP QGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKVEELRQHLWRWGFYTPDKKHQKEP PFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQK
Purity : >95% as determined by SDS-PAGE
Storage : Short Term Storage at +4°C. Long Term Storage at -20°C to -80°C. Avoid freeze/thaw cycles.

Related Gene

HIV-1HIV1

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy