"HIV-1 Reverse Transcriptase" Related Products

Recombinant HIV-1 Reverse Transcriptase, His-tagged

Cat.No.: HIV1 reversetranscriptase-01V
Product Overview: HIV-1 reverse transcriptase is an RNA-dependent DNA polymerase of HIV-1 virus, subtype B origin. It also has RNaseH activity and is an enzyme indispensable to the reproduction of AIDS virus. The product is uniquely over-expressed as a recombinant protein in E. coli. It is composed of two subunits (molecular weight of 35kD and 70 kD).
Source: E.coli
Species: Human immunodeficiency virus 1
Tag: His
Form: 20 mM Tris-HCl, 200 mM NaCl, pH7.4
Molecular Mass: ~35 kDa and ~70 kDa
AA Sequence: PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEEEGKISRIGPENPYNTPVFAIKKKDSTKWRKLV DFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGTRYQYNVLP QGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKVEELRQHLWRWGFYTPDKKHQKEP PFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQK
Purity: >95% as determined by SDS-PAGE
Storage: Short Term Storage at +4°C. Long Term Storage at -20°C to -80°C. Avoid freeze/thaw cycles.

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.