Recombinant HIV-1 Reverse Transcriptase, His-tagged
Cat.No. : | HIV1 reversetranscriptase-01V |
Product Overview : | Recombinant HIV-1 Reverse Transcriptase with His tag was expressed in E. coli. Theoretical pI: 8.51 |
Availability | August 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | HIV |
Source : | E.coli |
Tag : | His |
Description : | Reverse transcriptase, an enzyme encoded from the genetic material of retroviruses that catalyzes the transcription of retrovirus RNA (ribonucleic acid) into DNA (deoxyribonucleic acid). |
Molecular Mass : | ~ 35 kDa |
AA Sequence : | PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEEEGKISRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKVEELRQHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQK |
Purity : | ~ 95 % by SDS-PAGE analysis |
Storage : | Short term storage at +4 centigrade, Long term storage at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 1.0 mg/mL |
Storage Buffer : | 20 mM Tris-HCl, 200 mM NaCl, pH7.4 |
Official Symbol | HIV1 reversetranscriptase |
Synonyms | HIV1 reversetranscriptase; HIV-1 Reverse Transcriptase |
◆ Recombinant Proteins | ||
HIV1 reversetranscriptase-01V | Recombinant HIV-1 Reverse Transcriptase, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Reversetranscriptase Products
Required fields are marked with *
My Review for All Reversetranscriptase Products
Required fields are marked with *