Recombinant HIV-1 Reverse Transcriptase, His-tagged
| Cat.No. : | HIV1 reversetranscriptase-01V |
| Product Overview : | Recombinant HIV-1 Reverse Transcriptase with His tag was expressed in E. coli. Theoretical pI: 8.51 |
| Availability | July 13, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | HIV |
| Source : | E.coli |
| Tag : | His |
| Description : | Reverse transcriptase, an enzyme encoded from the genetic material of retroviruses that catalyzes the transcription of retrovirus RNA (ribonucleic acid) into DNA (deoxyribonucleic acid). |
| Molecular Mass : | ~ 35 kDa |
| AA Sequence : | PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEEEGKISRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKVEELRQHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQK |
| Purity : | ~ 95 % by SDS-PAGE analysis |
| Storage : | Short term storage at +4 centigrade, Long term storage at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
| Concentration : | 1.0 mg/mL |
| Storage Buffer : | 20 mM Tris-HCl, 200 mM NaCl, pH7.4 |
| Official Symbol | HIV1 reversetranscriptase |
| Synonyms | HIV1 reversetranscriptase; HIV-1 Reverse Transcriptase |
| ◆ Recombinant Proteins | ||
| HIV1 reversetranscriptase-01V | Recombinant HIV-1 Reverse Transcriptase, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Reversetranscriptase Products
Required fields are marked with *
My Review for All Reversetranscriptase Products
Required fields are marked with *




