"ERBB2" Related Products

Recombinant HER2/neu (478-584)

Cat.No.: ERBB2-01
Source: E.coli
Form: 20mM Tris-HCl, pH8.0, 200mM NaCl
Molecular Mass: (Theoretical molecular weight): ~12kDa
AA Sequence: LCFVHTVPWDQLFRNPHQALLHSGNRPEEDCGLEGLVCNSLCAHGHCWGPGPTQCVNCSH FLRGQECVEECRVWKGLPREYVSDKRCLPCHPECQPQNSSETCFGSE
Purity: >92% as determined by SDS-PAGE
Storage: Short Term Storage +4°C. Long Term Storage -20°C. Prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.
Gene Name: erbb2 v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog [ Xenopus laevis ]
Official Symbol: ERBB2
Synonyms: ERBB2; v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog; receptor tyrosine kinase ErbB2;
Gene ID: 724075
mRNA Refseq: NM_001095593
Protein Refseq: NP_001089062
Pathway: Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, conserved biosystem; Focal adhesion, organism-specific biosystem;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.