"Gm6484" Related Products

Recombinant Mouse Betatrophin, His-tagged

Cat.No.: Gm6484-01M
Product Overview: Mouse betatrophin (16-198) is fused at the N-terminus to a His-tag.
Source: E.coli
Species: Mouse
Tag: His
Form: 20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 2mM DTT.
Molecular Mass: ~26kDa with N-terminal His-tag
AA Sequence: VRPAPVAPLGGPEPAQYEELTLLFHGALQLGQALNGVYRATEARLTEAGHSLGLYDRALEFLGTEVRQGQDATQE LRTSLSEIQVEEDALHLRAEATARSLGEVARAQQALRDTVRRLQVQLRGAWLGQAHQEFETLKARADKQSHLLWA LTGHVQRQQREMAEQQQWLRQIQQRLHTAALPA
Purity: >95% as determined by SDS-PAGE
Storage: Short Term Storage +4°C. Long Term Storage -20°C. Prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.