Recombinant Mouse Betatrophin, His-tagged Gm6484-01M

Recombinant Mouse Betatrophin, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Mouse Betatrophin, His-tagged

Recombinant Mouse Betatrophin, His-tagged

Gm6484 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : Gm6484-01M
Product Overview : Mouse betatrophin (16-198) is fused at the N-terminus to a His-tag.
Source : E.coli
Species : Mouse
Tag : His
Form : 20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 2mM DTT.
Molecular Mass : ~26kDa with N-terminal His-tag
AA Sequence : VRPAPVAPLGGPEPAQYEELTLLFHGALQLGQALNGVYRATEARLTEAGHSLGLYDRALEFLGTEVRQGQDATQE LRTSLSEIQVEEDALHLRAEATARSLGEVARAQQALRDTVRRLQVQLRGAWLGQAHQEFETLKARADKQSHLLWA LTGHVQRQQREMAEQQQWLRQIQQRLHTAALPA
Purity : >95% as determined by SDS-PAGE
Storage : Short Term Storage +4°C. Long Term Storage -20°C. Prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.

Related Gene

GM2AGm900GM5581GM6185GM224GM98Gm885Gm949Gm221Gm6320Gm10081Gm10094Gm10096Gm101Gm10100Gm10104Gm10142Gm10147Gm10220Gm10229Gm10230Gm10267Gm10318Gm10324Gm10334Gm10345Gm10375Gm10391Gm10406Gm10436Gm11062Gm1110Gm11127Gm11128Gm1123Gm1140Gm11435Gm11437Gm11487Gm11541Gm11544Gm11545Gm11554Gm11559Gm11562Gm11563Gm11564Gm11565Gm11567Gm12253Gm12597Gm12657Gm12695Gm12789Gm12794Gm128Gm12824Gm12886Gm12887Gm12888Gm129Gm12942Gm13011Gm13023Gm13040Gm13043Gm13051Gm13242Gm13247Gm13251Gm13271Gm13272Gm13275Gm13276Gm13277Gm13278Gm13279Gm13280Gm13283Gm13285Gm13286Gm13287Gm13288Gm13289Gm13290Gm13298Gm13304Gm14308Gm14322Gm14325Gm14326Gm14345Gm14346Gm14347Gm14351Gm14374Gm14378Gm14391Gm14393Gm14420Gm14430Gm14431Gm14434Gm14436Gm14440Gm14685Gm14692Gm14725Gm14743Gm14744Gm14819Gm14850Gm14851Gm15023Gm15056Gm15070Gm15080Gm15085Gm15091Gm15093Gm15097Gm15104Gm15107Gm15114Gm16367Gm16381Gm16390Gm16404Gm16405Gm16430Gm16432Gm16442Gm1647Gm16501Gm166Gm1661Gm1673Gm1679Gm2030Gm216Gm2382Gm239Gm2506Gm266Gm2663Gm2696Gm2799Gm2825Gm2863Gm2897Gm2913Gm2933Gm3701Gm3706Gm3750Gm3763Gm3776Gm3985Gm4027Gm4070Gm410Gm4133Gm4141Gm4172Gm4175Gm4177Gm4179Gm4187Gm4201Gm4214Gm4788Gm4791Gm4794Gm4832Gm4836Gm4841Gm4846Gm4847Gm4858Gm4861Gm4871Gm4884Gm4894Gm4902Gm4906Gm4907Gm4922Gm4925Gm4937Gm514Gm5142Gm5148Gm5150Gm5168Gm5169Gm525Gm527Gm5294Gm5346Gm5347Gm5382Gm5414Gm5415Gm5416Gm5431Gm5458Gm5460Gm5662Gm572Gm5725Gm5726Gm5728Gm5741Gm5771Gm5797Gm5800Gm5803Gm581Gm5820Gm5868Gm5878Gm5885Gm5886Gm5887Gm5891Gm590Gm614Gm6164Gm6251Gm628Gm6289Gm6370Gm6377Gm6406Gm6408Gm6460Gm6484Gm6531Gm6537Gm6583Gm6588Gm6592Gm6614Gm7157Gm7168Gm7173Gm7244Gm7257Gm732Gm7325Gm749Gm7534Gm757Gm7616Gm765Gm766Gm7694Gm7714Gm773Gm7849Gm7861Gm7903Gm8882Gm889Gm8898Gm8909Gm8994Gm9Gm904Gm9047Gm906Gm9112Gm9125Gm9268Gm9376Gm94Gm9513Gm9524Gm962Gm97Gm16532Gm20172Gm16515Gm16517Gm14920Gm16445Gm16451Gm2022Gm5409Gm6222Gm7609Gm5894Gm14316Gm4934Gm5151Gm11428Gm1568Gm10058Gm10413Gm10439Gm1045Gm10471Gm10486Gm10487Gm10488Gm10591Gm106Gm10639Gm10665Gm10666Gm10670Gm10696Gm10697Gm10767Gm10778Gm10921Gm10922Gm11569Gm11595Gm11596Gm11710Gm11711Gm11744Gm11756Gm11757Gm11758Gm11818Gm11937Gm11938Gm11992Gm12Gm12169Gm12171Gm12185Gm12250Gm13057Gm13078Gm13083Gm13088Gm13102Gm13103Gm13109Gm13119Gm13124Gm13125Gm13128Gm13139Gm13152Gm13154Gm13157Gm13177Gm13178Gm1322Gm13305Gm13306Gm13308Gm1332Gm1337Gm13476Gm13547Gm136Gm13718Gm13871Gm13889Gm14085Gm14092Gm14124Gm14137Gm14139Gm14151Gm14288Gm14305Gm14446Gm14458Gm14459Gm14461Gm14483Gm14484Gm14501Gm14511Gm14525Gm14548Gm14632Gm15127Gm1527Gm15284Gm15292Gm15293Gm15308Gm15315Gm15319Gm15386Gm15455Gm156Gm1564Gm1574Gm1587Gm15881Gm1604bGm17019Gm1965Gm1987Gm1993Gm2002Gm2012Gm2016Gm20604Gm3238Gm3285Gm3286Gm3336Gm3417Gm3435Gm3448Gm3604Gm362Gm364Gm3646Gm3696Gm382Gm4216Gm4220Gm428Gm4297Gm4301Gm4302Gm4303Gm4305Gm4307Gm4312Gm4340Gm436Gm438Gm44Gm4498Gm4736Gm4745Gm4763Gm4787Gm4951Gm4952Gm4975Gm4980Gm4981Gm5072Gm5077Gm5082Gm5087Gm5111Gm5113Gm5114Gm5127Gm5128Gm5132Gm5134Gm5136Gm5464Gm5465Gm5483Gm5494Gm5506Gm5531Gm5538Gm5544Gm5567Gm5591Gm5592Gm5595Gm561Gm5615Gm5622Gm5634Gm5635Gm5640Gm5901Gm5916Gm5934Gm5935Gm5936Gm5938Gm5941Gm595Gm597Gm600Gm6026Gm6034Gm6040Gm606Gm608Gm6084Gm6086Gm6121Gm6696Gm6710Gm6760Gm6772Gm6792Gm6812Gm684Gm6878Gm6880Gm6890Gm6904Gm6907Gm7030Gm7073Gm7092Gm7102Gm711Gm7120Gm806Gm813Gm815Gm826Gm8267Gm829Gm8300Gm8369Gm8439Gm8453Gm853Gm8660Gm8677Gm8693Gm8720Gm8787Gm88Gm8817Gm884Gm9705Gm973Gm9733Gm9758Gm9992Gm17296Gm17365Gm17384Gm17495Gm17660Gm17677Gm17689Gm17727Gm20571Gm15299Gm4984Gm6927GM4738

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy