Recombinant Human WASL, GST-tagged WASL-320H

Recombinant Human WASL, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human WASL, GST-tagged

Recombinant Human WASL, GST-tagged

WASL Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : WASL-320H
Product Overview : Recombinant Human WASL(1 a.a. - 505 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description : This gene encodes a member of the Wiskott-Aldrich syndrome (WAS) protein family. Wiskott-Aldrich syndrome proteins share similar domain structure, and associate with a variety of signaling molecules to alter the actin cytoskeleton. The encoded protein is highly expressed in neural tissues, and interacts with several proteins involved in cytoskeletal organization, including cell division control protein 42 (CDC42) and the actin-related protein-2/3 (ARP2/3) complex. The encoded protein may be involved in the formation of long actin microspikes, and in neurite extension.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 81.2 kDa
AA Sequence : MSSVQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRS YFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRD PPNGPNLPMATVDIKNPEITTNRFYGPQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDL NNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHNSGPP PPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPP PPPPPPPPGPPPPPGLPSDGDHQVPTTAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSV ADGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDEDDEEDFEDDDEWED
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : WASL Wiskott-Aldrich syndrome-like [ Homo sapiens (human) ]
Official Symbol : WASL
Synonyms : WASL; Wiskott-Aldrich syndrome-like; neural Wiskott-Aldrich syndrome protein; N WASP; NWASP; Wiskott-Aldrich syndrome gene-like; N-WASP; MGC48327; DKFZp779G0847;
Gene ID : 8976
mRNA Refseq : NM_003941
Protein Refseq : NP_003932
MIM : 605056
UniProt ID : O00401
Chromosome Location : 7q31.3
Pathway : Adherens junction; CDC42 signaling events; Chemokine signaling pathway
Function : actin binding; protein binding; small GTPase regulator activity

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy