"DRD1" Related Products

Expand
Expand

Recombinant Human DRD1

Cat.No.: DRD1-10H
Product Overview: Recombinant Human DRD1, fused without tag, was expressed in wheat germ.
Description: This gene encodes the D1 subtype of the dopamine receptor. The D1 subtype is the most abundant dopamine receptor in the central nervous system. This G-protein coupled receptor stimulates adenylyl cyclase and activates cyclic AMP-dependent protein kinases. D1 receptors regulate neuronal growth and development, mediate some behavioral responses, and modulate dopamine receptor D2-mediated events. Alternate transcription initiation sites result in two transcript variants of this gene.
Source: Wheat germ
Species: Human
Form: Liquid
Molecular Mass: 49.3 kDa
AA Sequence: MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAV LVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKAAFILISVAWTL SVLISFIPVQLSWHKAKPTSPSDGNATSLAETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQI RRIAALERAAVHAKNCQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHH EPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT
Applications: Antibody Production; Functional Study; Compound Screening
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name: DRD1 dopamine receptor D1 [ Homo sapiens (human) ]
Official Symbol: DRD1
Synonyms: DRD1; dopamine receptor D1; DADR; DRD1A; D(1A) dopamine receptor; dopamine D1 receptor
Gene ID: 1812
mRNA Refseq: NM_000794
Protein Refseq: NP_000785
MIM: 126449
UniProt ID: P21728
Chromosome Location: 5q35.1
Pathway: Amine ligand-binding receptor; Amphetamine addiction; Class A/1 (Rhodopsin-like receptors)
Function: G-protein coupled amine receptor activity; dopamine binding; dopamine neurotransmitter receptor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.