Recombinant Human DRD5, GST-tagged

Cat.No. : DRD5-13H
Product Overview : Recombinant Human DRD5, fused with N-terminal GST, was expressed in E. coli.
Availability December 23, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Description : This gene encodes the D5 subtype of the dopamine receptor. The D5 subtype is a G-protein coupled receptor which stimulates adenylyl cyclase. This receptor is expressed in neurons in the limbic regions of the brain. It has a 10-fold higher affinity for dopamine than the D1 subtype. Pseudogenes related to this gene reside on chromosomes 1 and 2.
Form : 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol.
Bio-activity : Not tested.
AA Sequence : NSSLNPVIYAFNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTPGNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH(C-127aa encoded by BC009748)
Storage : Aliquot and store at -20ºC to -80ºC for up to 6 months. Avoid freeze thaw cycles.
Shipping : The product is shipped with ice packs. Upon receipt, store it immediately at -20ºC to -80ºC.
Gene Name DRD5 dopamine receptor D5 [ Homo sapiens (human) ]
Official Symbol DRD5
Synonyms DRD5; dopamine receptor D5; DBDR; DRD1B; DRD1L2; D(1B) dopamine receptor; D1beta dopamine receptor; d(5) dopamine receptor; dopamine D5 receptor; dopamine receptor D1B
Gene ID 1816
mRNA Refseq NM_000798
Protein Refseq NP_000789
MIM 126453
UniProt ID P21918
Chromosome Location 4p16.1
Pathway Amine ligand-binding receptors; Calcium signaling pathway; Defective ACTH causes Obesity and Pro-opiomelanocortinin deficiency (POMCD)
Function G-protein coupled amine receptor activity; dopamine binding; dopamine neurotransmitter receptor activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DRD5 Products

Required fields are marked with *

My Review for All DRD5 Products

Required fields are marked with *

0
cart-icon
0
compare icon