Recombinant Human DRD5, GST-tagged DRD5-13H

Recombinant Human DRD5, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human DRD5, GST-tagged

Recombinant Human DRD5, GST-tagged

DRD5 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : DRD5-13H
Product Overview : Recombinant Human DRD5, fused with N-terminal GST, was expressed in E. coli.
Description : This gene encodes the D5 subtype of the dopamine receptor. The D5 subtype is a G-protein coupled receptor which stimulates adenylyl cyclase. This receptor is expressed in neurons in the limbic regions of the brain. It has a 10-fold higher affinity for dopamine than the D1 subtype. Pseudogenes related to this gene reside on chromosomes 1 and 2.
Source : E. coli
Species : Human
Tag : GST
Form : 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol.
Bio-activity : Not tested.
AA Sequence : NSSLNPVIYAFNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTPGNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH(C-127aa encoded by BC009748)
Storage : Aliquot and store at -20ºC to -80ºC for up to 6 months. Avoid freeze thaw cycles.
Shipping : The product is shipped with ice packs. Upon receipt, store it immediately at -20ºC to -80ºC.
Gene Name : DRD5 dopamine receptor D5 [ Homo sapiens (human) ]
Official Symbol : DRD5
Synonyms : DRD5; dopamine receptor D5; DBDR; DRD1B; DRD1L2; D(1B) dopamine receptor; D1beta dopamine receptor; d(5) dopamine receptor; dopamine D5 receptor; dopamine receptor D1B
Gene ID : 1816
mRNA Refseq : NM_000798
Protein Refseq : NP_000789
MIM : 126453
UniProt ID : P21918
Chromosome Location : 4p16.1
Pathway : Amine ligand-binding receptors; Calcium signaling pathway; Defective ACTH causes Obesity and Pro-opiomelanocortinin deficiency (POMCD)
Function : G-protein coupled amine receptor activity; dopamine binding; dopamine neurotransmitter receptor activity

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy