"DRD5" Related Products

Expand

Recombinant Human DRD5, GST-tagged

Cat.No.: DRD5-13H
Product Overview: Recombinant Human DRD5, fused with N-terminal GST, was expressed in E. coli.
Description: This gene encodes the D5 subtype of the dopamine receptor. The D5 subtype is a G-protein coupled receptor which stimulates adenylyl cyclase. This receptor is expressed in neurons in the limbic regions of the brain. It has a 10-fold higher affinity for dopamine than the D1 subtype. Pseudogenes related to this gene reside on chromosomes 1 and 2.
Source: E. coli
Species: Human
Tag: GST
Form: 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol.
Bio-activity: Not tested.
AA Sequence: NSSLNPVIYAFNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTPGNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH(C-127aa encoded by BC009748)
Storage: Aliquot and store at -20ºC to -80ºC for up to 6 months. Avoid freeze thaw cycles.
Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20ºC to -80ºC.
Gene Name: DRD5 dopamine receptor D5 [ Homo sapiens (human) ]
Official Symbol: DRD5
Synonyms: DRD5; dopamine receptor D5; DBDR; DRD1B; DRD1L2; D(1B) dopamine receptor; D1beta dopamine receptor; d(5) dopamine receptor; dopamine D5 receptor; dopamine receptor D1B
Gene ID: 1816
mRNA Refseq: NM_000798
Protein Refseq: NP_000789
MIM: 126453
UniProt ID: P21918
Chromosome Location: 4p16.1
Pathway: Amine ligand-binding receptors; Calcium signaling pathway; Defective ACTH causes Obesity and Pro-opiomelanocortinin deficiency (POMCD)
Function: G-protein coupled amine receptor activity; dopamine binding; dopamine neurotransmitter receptor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.