Recombinant Full Length Mouse D(1B) Dopamine Receptor(Drd5) Protein, His-Tagged
Cat.No. : | RFL16471MF |
Product Overview : | Recombinant Full Length Mouse D(1B) dopamine receptor(Drd5) Protein (Q8BLD9) (1-478aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-478) |
Form : | Lyophilized powder |
AA Sequence : | MLPPGRNGTAHRARLGLQRQLAQVDAPGGSAAPLGPAQVVTAGLLTLLIVWTLLGNVLVC AAIVRSRHLRAKMTNIFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDIWVAFDIM CSTASILNLCIISVDRYWAISRPFRYERKMTQRVALVMVALAWTLSILISFIPVQLNWHR DKAGSQGREGLLSNETPWEEGWELDGRTENCDSSLNRTYAISSSLISFYIPVAIMIVTYT RIYRIAQVQIRRISSLERAAEHAQSCRSRGACEPDPSLRASIKKETKVFKTLSVIMGVFV CCWLPFFILNCMVPFCSSGDAQGPRTGFPCVSETTFDIFVWFGWANSSLNPIIYAFNADF RKVFAQLLGCSHLCFRTPVQTVNISNELISYNQDTVFHREIAAAYVHMIPNAVSSGDREV GEEEEAEEEGPFDHMSQISPTTPDGDLAAESVWELDCEEEVSLGKISPLTPNCFHKTA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Drd5 |
Synonyms | Drd5; D(1B dopamine receptor; D(5 dopamine receptor; Dopamine D5 receptor |
UniProt ID | Q8BLD9 |
◆ Recombinant Proteins | ||
RFL16471MF | Recombinant Full Length Mouse D(1B) Dopamine Receptor(Drd5) Protein, His-Tagged | +Inquiry |
DRD5-1992H | Recombinant Human DRD5 Protein (Asn351-His477), His tagged | +Inquiry |
DRD5-1993H | Recombinant Human DRD5 Protein (Phe361-His477), N-His tagged | +Inquiry |
DRD5-12165H | Recombinant Human DRD5, His-tagged | +Inquiry |
DRD5-1959R | Recombinant Rat DRD5 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DRD5-6816HCL | Recombinant Human DRD5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Drd5 Products
Required fields are marked with *
My Review for All Drd5 Products
Required fields are marked with *
0
Inquiry Basket