"ADA" Related Products

Expand
Expand

Native Bovine adenosine deaminase therapeutic protein (Pegademase bovine)

Cat.No.: ADA-P036B
Product Overview: Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life.
Source: bovine intestine
Species: Bovine
CAS number: 9026-93-1
Molecular Mass: 40.8 kDa
AA Sequence: MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPEFLAKFDYYMPA IAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGER DFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTV HAGEVGSANVVKEAVDTLKTERLGHGYHTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFK NDQVNYSLNTDDPLIFKSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPS PASAEQCL
Endotoxin: < 0.1 eu per μg of the
Purity: >98%
Gene Name: ADA adenosine deaminase [ Bos taurus ]
Official Symbol: ADA
Synonyms: adenosine deaminase; adenosine aminohydrolase
Gene ID: 280712
mRNA Refseq: NM_173887
Protein Refseq: NP_776312
UniProt ID: P56658
Chromosome Location: chromosome: 13
Pathway: Metabolic pathways, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Purine metabolism, organism-specific biosystem
Function: adenosine deaminase activity; adenosine deaminase activity; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.