Native Bovine adenosine deaminase therapeutic protein (Pegademase bovine)
| Cat.No. : | ADA-P036B |
| Product Overview : | Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | Bovine Intestine |
| Tag : | Non |
| CAS number : | 9026-93-1 |
| Molecular Mass : | 40.8 kDa |
| AA Sequence : | MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPEFLAKFDYYMPA IAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGER DFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTV HAGEVGSANVVKEAVDTLKTERLGHGYHTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFK NDQVNYSLNTDDPLIFKSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPS PASAEQCL |
| Endotoxin : | < 0.1 eu per μg of the |
| Purity : | >98% |
| Gene Name | ADA adenosine deaminase [ Bos taurus ] |
| Official Symbol | ADA |
| Synonyms | adenosine deaminase; adenosine aminohydrolase |
| Gene ID | 280712 |
| mRNA Refseq | NM_173887 |
| Protein Refseq | NP_776312 |
| UniProt ID | P56658 |
| Chromosome Location | chromosome: 13 |
| Pathway | Metabolic pathways, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Purine metabolism, organism-specific biosystem |
| Function | adenosine deaminase activity; adenosine deaminase activity; protein binding |
| ◆ Recombinant Proteins | ||
| ADA-1271M | Recombinant Mouse ADA Protein | +Inquiry |
| ADA-1007H | Recombinant Human ADA, His-tagged | +Inquiry |
| ADA-40H | Recombinant Human ADA Protein, 1-363aa, N-His tagged | +Inquiry |
| ADA-268H | Recombinant Human ADA Protein, GST-tagged | +Inquiry |
| ADA-1112H | Active Recombinant Human ADA protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| ADA-P036B | Native Bovine adenosine deaminase therapeutic protein (Pegademase bovine) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADA-001HCL | Recombinant Human ADA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADA Products
Required fields are marked with *
My Review for All ADA Products
Required fields are marked with *
