Native Bovine adenosine deaminase therapeutic protein (Pegademase bovine)

PRODUCTS

Home / Products / Native Bovine adenosine deaminase therapeutic protein (Pegademase bovine)

Native Bovine adenosine deaminase therapeutic protein (Pegademase bovine)

ADA Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ADA-P036B
Product Overview : Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life.
Source : bovine intestine
Species : Bovine
CAS number : 9026-93-1
Molecular Mass : 40.8 kDa
AA Sequence : MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPEFLAKFDYYMPA IAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGER DFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTV HAGEVGSANVVKEAVDTLKTERLGHGYHTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFK NDQVNYSLNTDDPLIFKSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPS PASAEQCL
Endotoxin : < 0.1 eu per μg of the
Purity : >98%
Gene Name : ADA adenosine deaminase [ Bos taurus ]
Official Symbol : ADA
Synonyms : adenosine deaminase; adenosine aminohydrolase
Gene ID : 280712
mRNA Refseq : NM_173887
Protein Refseq : NP_776312
UniProt ID : P56658
Chromosome Location : chromosome: 13
Pathway : Metabolic pathways, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Purine metabolism, organism-specific biosystem
Function : adenosine deaminase activity; adenosine deaminase activity; protein binding

Online Inquiry


  •  
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information
  • Note: There will be extra charge for optional service!

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.