Native Bovine adenosine deaminase therapeutic protein (Pegademase bovine)
Cat.No. : | ADA-P036B |
Product Overview : | Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | Bovine Intestine |
Tag : | Non |
CAS number : | 9026-93-1 |
Molecular Mass : | 40.8 kDa |
AA Sequence : | MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPEFLAKFDYYMPA IAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGER DFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTV HAGEVGSANVVKEAVDTLKTERLGHGYHTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFK NDQVNYSLNTDDPLIFKSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPS PASAEQCL |
Endotoxin : | < 0.1 eu per μg of the |
Purity : | >98% |
Gene Name | ADA adenosine deaminase [ Bos taurus ] |
Official Symbol | ADA |
Synonyms | adenosine deaminase; adenosine aminohydrolase |
Gene ID | 280712 |
mRNA Refseq | NM_173887 |
Protein Refseq | NP_776312 |
UniProt ID | P56658 |
Chromosome Location | chromosome: 13 |
Pathway | Metabolic pathways, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Purine metabolism, organism-specific biosystem |
Function | adenosine deaminase activity; adenosine deaminase activity; protein binding |
◆ Recombinant Proteins | ||
ADA-499R | Recombinant Rat ADA Protein | +Inquiry |
ADA-268H | Recombinant Human ADA Protein, GST-tagged | +Inquiry |
ADA-1271M | Recombinant Mouse ADA Protein | +Inquiry |
ADA-1007H | Recombinant Human ADA, His-tagged | +Inquiry |
ADA-303M | Recombinant Mouse ADA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
ADA-P036B | Native Bovine adenosine deaminase therapeutic protein (Pegademase bovine) | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADA-001HCL | Recombinant Human ADA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADA Products
Required fields are marked with *
My Review for All ADA Products
Required fields are marked with *