"ASRGL1" Related Products

Expand
Expand
Expand

Recombinant Human ASRGL1 therapeutic protein

Cat.No.: ASRGL1-P040H
Product Overview: Pegylated L-asparagine amidohydrolase from E. coli. Pegylation substantially (by a factor of 4) extends the protein half life. It is a modified enzyme used as an antineoplastic agent. It is a form of L-asparaginase which has undergone PEGylation. It is used in the treatment of acute lymphoblastic leukemia.
Description: Recombinant Human L-asparaginase, more effective than asparaginase, converts asparagine to aspartic acid and ammonia. It facilitates production of oxaloacetate which is needed for general cellular metabolism. Some malignant cells lose the ability to produce asparagine and so the loss of exogenous sources of asparagine leads to cell death.
Source: E. coli
Species: Human
Molecular Mass: 31.7 kDa
AA Sequence: MEFFKKTALAALVMGFSGAALALPNITILATGGTIAGGGDSATKSNYTVGKVGVENLVNAVPQLKDIANVK GEQVVNIGSQDMNDNVWLTLAKKINTDCDKTDGFVITHGTDTMEETAYFLDLTVKCDKPVVMVGAMRPSTS MSADGPFNLYNAVVTAADKASANRGVLVVMNDTVLDGRDVTKTNTTDVATFKSVNYGPLGYIHNGKIDYQR TPARKHTSDTPFDVSKLNELPKVGIVYNYANASDLPAKALVDAGYDGIVSAGVGNGNLYKSVFDTLATAAK TGTAVVRSSRVPTGATTQDAEVDDAKYGFVASGTLNPQKARVLLQLALTQTKDPQQIQQIFNQY
Endotoxin: < 0.1 EU per μg of the protein
Purity: >95%
Gene Name: ASRGL1 asparaginase like 1 [ Homo sapiens ]
Official Symbol: ASRGL1
Synonyms: ALP; ALP1; CRASH; L-asparaginase; L-asparagine amidohydrolase; asparaginase-like 1 protein; asparaginase-like protein 1; beta-aspartyl-peptidase; isoaspartyl dipeptidase; testis secretory sperm-binding protein Li 242mP
Gene ID: 80150
mRNA Refseq: NM_001083926
Protein Refseq: NP_001077395
MIM: 609212
UniProt ID: Q7L266
Chromosome Location: 11q12.3
Pathway: Histidine, lysine, phenylalanine, tyrosine, proline and tryptophan catabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem
Function: NOT N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity; asparaginase activity; beta-aspartyl-peptidase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.