Native Human ALB therapeutic protein

Cat.No. : ALB-P042H
Product Overview : A diagnostic radiopharmaceutical containing iodinated I 131 albumin for intravenous imaging. Following intravenous injection, radioiodinated albumin human is uniformly distributed throughout the intravascular pool within 10 minutes; extravascular distribution takes place more slowly (2 days). Indicated for use in determinations of total blood and plasma volumes, cardiac output, cardiac and pulmonary blood volumes and circulation times
Description : Regulates the colloidal osmotic pressure of blood. It is used to increase the circulating plasma volume, thereby reducing hemoconcentrtion and blood viscosity. Also used as a transport protein that binds naturally occurring, therapeutic and toxic materials in circulation.
Species : Human
Molecular Mass : 66.5 kDa
AA Sequence : MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVT EFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRP EVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEG KASSAKQGLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADL AKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVGSKDVCKNYAEAKDVFLGMFL YEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQL GEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDCLSVFLNQLCVLHEKTPV SDRVTKCCTESLVNGRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKAT KEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLV
Endotoxin : < 0.1 EU per μg of the protein
Purity : >95%
Gene Name : ALB albumin [ Homo sapiens ]
Official Symbol : ALB
Synonyms : ALB; albumin; serum albumin; albumin (32 AA); albumin (AA 34); growth-inhibiting protein 20; cell growth inhibiting protein 42; PRO0883; PRO0903; PRO1341; DKFZp779N1935;
Gene ID : 213
mRNA Refseq : NM_000477
Protein Refseq : NP_000468
UniProt ID : P02768
Chromosome Location : 4q13.3
Pathway : Bile acid and bile salt metabolism, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; HDL-mediated lipid transport, organism-specific biosystem; Hemostasis, organism-specific biosystem; Lipid digestion, mobilization, and transport, organism-specific biosystem; Lipoprotein metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem;
Function : DNA binding; antioxidant activity; cell surface binding; chaperone binding; copper ion binding; drug binding; drug binding; enzyme binding; fatty acid binding; fatty acid binding; metal ion binding; contributes_to oxygen binding; protein binding; pyridoxal phosphate binding; toxin binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.