Recombinant Human AGR2, His-tagged

Cat.No. : AGR2-63H
Product Overview : Recombinant Human Anterior Gradient Homolog 2 fused to His-tag on N-terminal produced inE.Coliis a single, non-glycosylated polypeptide chain containing 192 amino acids (21-175) & having a molecular mass of 22 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : AGR2 (Anterior gradient 2 homolog) is the human orthologue of the secreted Xenopus laevis Anterior Gradient protein (XAG-2). This is a small, possibly secreted molecule of yet weakly defined functions that is widely expressed in human tissues. Expression of AGR2 shows a positive correlation with expression of estrogen receptor in breast carcinoma and a negative correlation with expression of EGF receptor.
Sequence : MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMRDTTVKPGAKKDKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQAL KKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQ YVPRIMFVDPSLTVRADITGRYSNRLYAYE PADTALLLDNMKKALKLLKTEL
Physical Appearance : Sterile filtered clorless solution.
Purity : Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Formulation : The protein (1mg/ml) contains 1X PBS pH-7.4
Applications : • ELISA • MS • Inhibition Assays • Western Blotting
Storage : Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles
Gene Name anterior gradient homolog 2 (Xenopus laevis) [ Homo sapiens ]
Synonyms AG2; GOB-4; HAG-2; XAG-2; PDIA17; AGR2; anterior gradient 2 homolog; secreted cement gland homolog; protein disulfide isomerase family A, member 17; Anterior gradient protein 2 homolog; hAG-2; AG-2; Secreted cement gland protein XAG-2 homolog; HPC8; UNQ515/PRO1030
Gene ID 10551
mRNA Refseq NM_006408
Protein Refseq NP_006399
MIM 606358
UniProt ID O95994
Chromosome Location 7p21.3
Function protein binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AGR2 Products

Required fields are marked with *

My Review for All AGR2 Products

Required fields are marked with *

0
cart-icon