Recombinant Human AGR2, His-tagged AGR2-63H

Recombinant Human AGR2, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human AGR2, His-tagged

Recombinant Human AGR2, His-tagged

AGR2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat. No. : AGR2-63H
Product Overview : Recombinant Human Anterior Gradient Homolog 2 fused to His-tag on N-terminal produced inE.Coliis a single, non-glycosylated polypeptide chain containing 192 amino acids (21-175) & having a molecular mass of 22 kDa.
Description : AGR2 (Anterior gradient 2 homolog) is the human orthologue of the secreted Xenopus laevis Anterior Gradient protein (XAG-2). This is a small, possibly secreted molecule of yet weakly defined functions that is widely expressed in human tissues. Expression of AGR2 shows a positive correlation with expression of estrogen receptor in breast carcinoma and a negative correlation with expression of EGF receptor.
Source : Escherichia Coli.
Sequence : MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMRDTTVKPGAKKDKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQAL KKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQ YVPRIMFVDPSLTVRADITGRYSNRLYAYE PADTALLLDNMKKALKLLKTEL
Physical Appearance : Sterile filtered clorless solution.
Purity : Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Formulation : The protein (1mg/ml) contains 1X PBS pH-7.4
Applications : • ELISA • MS • Inhibition Assays • Western Blotting
Storage : Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles
Gene Name : anterior gradient homolog 2 (Xenopus laevis) [ Homo sapiens ]
Synonyms : AG2; GOB-4; HAG-2; XAG-2; PDIA17; AGR2; anterior gradient 2 homolog; secreted cement gland homolog; protein disulfide isomerase family A, member 17; Anterior gradient protein 2 homolog; hAG-2; AG-2; Secreted cement gland protein XAG-2 homolog; HPC8; UNQ515/PRO1030
Gene ID : 10551
mRNA Refseq : NM_006408
Protein Refseq : NP_006399
MIM : 606358
UniProt ID : O95994
Chromosome Location : 7p21.3
Function : protein binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy