"AGR2" Related Products

Expand
Expand

Recombinant Human AGR2, His-tagged

Cat. No. : AGR2-63H
Product Overview : Recombinant Human Anterior Gradient Homolog 2 fused to His-tag on N-terminal produced inE.Coliis a single, non-glycosylated polypeptide chain containing 192 amino acids (21-175) & having a molecular mass of 22 kDa.
Description : AGR2 (Anterior gradient 2 homolog) is the human orthologue of the secreted Xenopus laevis Anterior Gradient protein (XAG-2). This is a small, possibly secreted molecule of yet weakly defined functions that is widely expressed in human tissues. Expression of AGR2 shows a positive correlation with expression of estrogen receptor in breast carcinoma and a negative correlation with expression of EGF receptor.
Source : Escherichia Coli.
Sequence : MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMRDTTVKPGAKKDKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQAL KKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQ YVPRIMFVDPSLTVRADITGRYSNRLYAYE PADTALLLDNMKKALKLLKTEL
Physical Appearance : Sterile filtered clorless solution.
Purity : Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Formulation : The protein (1mg/ml) contains 1X PBS pH-7.4
Applications : • ELISA • MS • Inhibition Assays • Western Blotting
Storage : Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles
Gene Name : anterior gradient homolog 2 (Xenopus laevis) [ Homo sapiens ]
Synonyms : AG2; GOB-4; HAG-2; XAG-2; PDIA17; AGR2; anterior gradient 2 homolog; secreted cement gland homolog; protein disulfide isomerase family A, member 17; Anterior gradient protein 2 homolog; hAG-2; AG-2; Secreted cement gland protein XAG-2 homolog; HPC8; UNQ515/PRO1030
Gene ID : 10551
mRNA Refseq : NM_006408
Protein Refseq : NP_006399
MIM : 606358
UniProt ID : O95994
Chromosome Location : 7p21.3
Function : protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.