Recombinant Human AGR2 protein, GST-tagged
| Cat.No. : | AGR2-1522H |
| Product Overview : | Recombinant Human AGR2 protein(17-175 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 17-175 aa |
| Tag : | N-GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | YTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL |
| Gene Name | AGR2 anterior gradient 2 homolog (Xenopus laevis) [ Homo sapiens ] |
| Official Symbol | AGR2 |
| Synonyms | AGR2; anterior gradient 2 homolog (Xenopus laevis); anterior gradient protein 2 homolog; AG2; HAG 2; PDIA17; protein disulfide isomerase family A; member 17; XAG 2; AG-2; HPC8; anterior gradient homolog 2; secreted cement gland homolog; secreted cement gland protein XAG-2 homolog; protein disulfide isomerase family A, member 17; GOB-4; HAG-2; XAG-2; |
| Gene ID | 10551 |
| mRNA Refseq | NM_006408 |
| Protein Refseq | NP_006399 |
| MIM | 606358 |
| UniProt ID | O95994 |
| ◆ Recombinant Proteins | ||
| AGR2-520H | Recombinant Human AGR2 Protein, MYC/DDK-tagged | +Inquiry |
| AGR2-101R | Recombinant Rhesus Macaque AGR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| AGR2-0167H | Recombinant Human AGR2 Protein (Arg21-Leu175), His-tagged | +Inquiry |
| AGR2-63H | Recombinant Human AGR2, His-tagged | +Inquiry |
| AGR2-26141TH | Recombinant Human AGR2, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AGR2-8972HCL | Recombinant Human AGR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGR2 Products
Required fields are marked with *
My Review for All AGR2 Products
Required fields are marked with *
