Recombinant Human ENPP2, His-tagged ENPP2-3123H

Recombinant Human ENPP2, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human ENPP2, His-tagged

Recombinant Human ENPP2, His-tagged

ENPP2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ENPP2-3123H
Product Overview : Recombinant human ENPP2/ATX (ectonucleotide pyrophosphatase-phosphodiesterase 2) is a single polypeptide chain with a 8His tag at the C-terminus. It contains 925 (915+10) amino acids, and having a predicted molecular mass of approximately 106.4kD and migrates in SDS-PAGE with an apparent molecular mass of 110kD.
Description : Autotaxin also known as ectonucleotide pyrophosphatase/phosphodiesterase family member 2 (E-NPP 2) is an enzyme that in humans is encoded by the ENPP2 gene.
Source : HEK293
Species : Human
Tag : His
Form : 20mM Tris-Cl (pH7.9), 20% Glycerol, 100mM NaCl, 1mM DTT and 0.5mM EDTA
Bio-activity : ENPP2 protein stimulates the motility of tumor cells with angiogenic properties. It functions as a phosphodiesterase to cleave phosphodiester bonds and a phospholipase to catalyze production of lysophosphatidic acid (LPA). Recombinant human ENPP2 protein is ideal for the studies of its enzyme activity and other related function assays
AA Sequence : MARRSSFQSCQIISLFTFAVGVNICLGFTAHRIKRAEGWEEGPPTVLSDSPWTNISGSCKGRCFELQEAGPPDC RCDNLCKSYTSCCHDFDELCLKTARGWECTKDRCGEVRNEENACHCSEDCLARGDCCTNYQVVCKGESHWVDDD CEEIKAAECPAGFVRPPLIIFSVDGFRASYMKKGSKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGL YPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITATKQGVKAGTFFWSVVIPHERRILTILQWLTL PDHERPSVYAFYSEQPDFSGHKYGPFGPEESSYGSPFTPAKRPKRKVAPKRRQERPVAPPKKRRRKIHRMDHY AAETRQDKMTNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCDRTEFLSNYLTNVDDITLVPGTL GRIRSKFSNNAKYDPKAIIANLTCKKPDQHFKPYLKQHLPKRLHYANNRRIEDIHLLVERRWHVARKPLDVYK KPSGKCFFQGDHGFDNKVNSMQTVFVGYGSTFKYKTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRT NTFRPTMPEEVTRPNYPGIMYLQSDFDLGCTCDDKVEPKNKLDELNKRLHTKGSTEERHLLYGRPAVLYRTRY DILYHTDFESGYSEIFLMPLWTSYTVSKQAEVSSVPDHLTSCVRPDVRVSPSFSQNCLAYKNDKQMSYGFLFPP YLSSSPEAKYDAFLVTNMVPMYPAFKRVWNYFQRVLVKKYASERNGVNVISGPIFDYDYDGLHDTEDKIKQYV EGSSIPVPTHYYSIITSCLDFTQPADKCDGPLSVSSFILPHRPDNEESCNSSEDESKWVEELMKMHTARVRDIE HLTSLDFFRKTSRSYPEILTLKTYLHTYESEIGGHHHHHHHH
Purity : ≥90%, as determined by SDS-PAGE
Usage : FOR RESEARCH ONLY
Storage : The protein sample can be stored under sterile conditions at 2- 8 centigrade for one month or at -70 centigrade for three months without detectable loss of activity. Avoid repeated freeze-thaw cycles.
Gene Name : ENPP2 ectonucleotide pyrophosphatase/phosphodiesterase 2 [ Homo sapiens ]
Official Symbol : ENPP2
Synonyms : ATX; NPP2; ATX-X; PDNP2; LysoPLD; AUTOTAXIN; PD-IALPHA; ectonucleotide pyrophosphatase/phosphodiesterase family member 2; E-NPP 2; autotaxin-t; extracellular lysophospholipase D; phosphodiesterase I/nucleotide pyrophosphatase 2; plasma lysophospholipase D
Gene ID : 5168
mRNA Refseq : NM_001040092
Protein Refseq : NP_001035181
MIM : 601060
UniProt ID : Q13822
Chromosome Location : 8q24.1
Pathway : Ether lipid metabolism, organism-specific biosystem; Ether lipid metabolism, conserved biosystem
Function : alkylglycerophosphoethanolamine phosphodiesterase activity; calcium ion binding; hydrolase activity

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy