"C10orf54" Related Products

Expand
Expand

Recombinant Mouse 4632428N05Rik, Fc-tagged

Cat.No.: C10orf54-26M
Product Overview: Recombinant Mouse 4632428N05Rik(Phe33 - Ala191), exists as a dimer under non-reducing condition, fused to Fc fusion from human IgG1 at C-terminus, was expressed in Human cells.
Description: B7-H5 (B7 homolog 5), also known as platelet receptor Gi24, C10orf54, Dies1, VISTA, PD-1H and SISP1, is a single-pass type I transmembrane glycoprotein that belongs to the B7 family of the Ig superfamily. Unlike other B7 family members that usually contain one Ig V-like and one Ig C-like domain in the extracellular region, mature B7-H5 has only one Ig V- like domain. B7-H5 is expressed in bone, on embryonic stem cells (ESCs), and on tumor cell surfaces. On ESCs, it interacts with BMP-4 and potentiates BMP signaling and the transition from an undifferentiated to a differentiated state. On tumor cells, B7-H5 both promotes MT1-MMP expression and activity and serves as a substrate for MT1-MMP. This increases the potential for cell motility. B7-H5 can be shed by MT1­MMP, generating a soluble 30 kDa extracellular fragment and a 25-30 kDa membrane-bound fragment. B7-H5 is expressed on the surface of naïve CD4+ T cells and regulatory T cells. Its expression is up­regulated in vivo on activated monocytes and dendritic cells. It is reported that B7-H5 inhibits CD4+ and CD8+ T cell proliferation, and their production of IL­2 and IFN­γ. Its expression on tumor cells attenuates the anti­tumor immune response and enables more rapid tumor progression. In contrast, it has also been reported that B7-H5 limits disease progression in the autoimmune disease model EAE.
Source: Human cells
Species: Mouse
Tag: Fc
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).
Bio-activity: Inhibits anti­CD3e antibody induced IL­2 secretion and T cell proliferation.
Molecular Mass: Calculated molecular mass 43.3 kDa; estimated by SDS-PAGE under reducing condition 65-70 kDa probably due to glycosylation
AA Sequence: FKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAA NTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVY PSSSQDSENITAASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS REEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM HEALHNHYTQKSLSLSPGK
Endotoxin: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Purity: >95% judged by SDS-PAGE under reducing condition
Stability: It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
Warning: FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Gene Name: 4632428N05Rik RIKEN cDNA 4632428N05 gene [ Mus musculus ]
Official Symbol: 4632428N05Rik
Synonyms: Dies1; PD-1H; VISTA; platelet receptor Gi24; differentiation of ESCs 1
Gene ID: 74048
mRNA Refseq: NM_001159572
Protein Refseq: NP_001153044
UniProt ID: Q9D659
Chromosome Location: 10; 10 B4
Function: protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.