Recombinant Human ITSN1, GST-tagged
| Cat.No. : | ITSN1-16H |
| Product Overview : | Recombinant Human ITSN1(588 a.a. - 675 a.a) fussed with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 588-675 a.a. |
| Description : | The protein encoded by this gene is a cytoplasmic membrane-associated protein that indirectly coordinates endocytic membrane traffic with the actin assembly machinery. In addition, the encoded protein may regulate the formation of clathrin-coated vesicles and could be involved in synaptic vesicle recycling. This protein has been shown to interact with dynamin, CDC42, SNAP23, SNAP25, SPIN90, EPS15, EPN1, EPN2, and STN2. Multiple transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been characterized so far. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 35.42 kDa |
| AA Sequence : | EVEKETRSKLQEIDIFNNQLKELREIHNKQQLQKQKSMEAERLKQKEQERKIIELEKQKEEAQRRAQERDKQWLE HVQQEDEHQRPRK |
| Applications : | AP, Array, ELISA, WB-Re |
| Usage : | For research use only (RUO) |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | ITSN1 intersectin 1 (SH3 domain protein) [ Homo sapiens ] |
| Official Symbol | ITSN1 |
| Synonyms | ITSN; SH3D1A; SH3P17; intersectin-1; SH3 domain-containing protein 1A; Src homology 3 domain-containing protein; human intersectin-SH3 domain-containing protein SH3P17; intersectin 1 short form variant 3; intersectin 1 short form variant, 11; intersectin short variant 12 |
| Gene ID | 6453 |
| mRNA Refseq | NM_003024 |
| Protein Refseq | NP_003015 |
| MIM | 602442 |
| UniProt ID | Q15811 |
| Chromosome Location | 21q22.1-q22.2 |
| Pathway | Axon guidance, organism-specific biosystem; Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem; Developmental Biology, organism-specific biosystem |
| Function | Rho guanyl-nucleotide exchange factor activity; calcium ion binding; guanyl-nucleotide exchange factor activity |
| ◆ Recombinant Proteins | ||
| ITSN1-4660M | Recombinant Mouse ITSN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ITSN1-16H | Recombinant Human ITSN1, GST-tagged | +Inquiry |
| Itsn1-7873R | Recombinant Rat Itsn1 protein, His & T7-tagged | +Inquiry |
| Itsn1-1702M | Recombinant Mouse Itsn1 Protein, His-tagged | +Inquiry |
| ITSN1-11829Z | Recombinant Zebrafish ITSN1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ITSN1-09H | Recombinant Human ITSN1 Over-expression Lysate, C-Flag tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITSN1 Products
Required fields are marked with *
My Review for All ITSN1 Products
Required fields are marked with *
