Recombinant Human ITSN1, GST-tagged ITSN1-16H

Recombinant Human ITSN1, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human ITSN1, GST-tagged

Recombinant Human ITSN1, GST-tagged

ITSN1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ITSN1-16H
Product Overview : Recombinant Human ITSN1(588 a.a. - 675 a.a) fussed with GST tag at N-terminal was expressed in Wheat Germ.
Description : The protein encoded by this gene is a cytoplasmic membrane-associated protein that indirectly coordinates endocytic membrane traffic with the actin assembly machinery. In addition, the encoded protein may regulate the formation of clathrin-coated vesicles and could be involved in synaptic vesicle recycling. This protein has been shown to interact with dynamin, CDC42, SNAP23, SNAP25, SPIN90, EPS15, EPN1, EPN2, and STN2. Multiple transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been characterized so far.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 35.42 kDa
AA Sequence : EVEKETRSKLQEIDIFNNQLKELREIHNKQQLQKQKSMEAERLKQKEQERKIIELEKQKEEAQRRAQERDKQWLE HVQQEDEHQRPRK
Applications : AP, Array, ELISA, WB-Re
Usage : For research use only (RUO)
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : ITSN1 intersectin 1 (SH3 domain protein) [ Homo sapiens ]
Official Symbol : ITSN1
Synonyms : ITSN; SH3D1A; SH3P17; intersectin-1; SH3 domain-containing protein 1A; Src homology 3 domain-containing protein; human intersectin-SH3 domain-containing protein SH3P17; intersectin 1 short form variant 3; intersectin 1 short form variant, 11; intersectin short variant 12
Gene ID : 6453
mRNA Refseq : NM_003024
Protein Refseq : NP_003015
MIM : 602442
UniProt ID : Q15811
Chromosome Location : 21q22.1-q22.2
Pathway : Axon guidance, organism-specific biosystem; Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem; Developmental Biology, organism-specific biosystem
Function : Rho guanyl-nucleotide exchange factor activity; calcium ion binding; guanyl-nucleotide exchange factor activity

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy