Recombinant Human ITSN1 Protein, N-6×His-ABP tagged

Cat.No. : ITSN1-13H
Product Overview : A recombinant protein antigen with a N-terminal 6×His-ABP tag corresponding to human ITSN1.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : ABP&His
Description : The protein encoded by this gene is a cytoplasmic membrane-associated protein that indirectly coordinates endocytic membrane traffic with the actin assembly machinery. In addition, the encoded protein may regulate the formation of clathrin-coated vesicles and could be involved in synaptic vesicle recycling. This protein has been shown to interact with dynamin, CDC42, SNAP23, SNAP25, SPIN90, EPS15, EPN1, EPN2, and STN2. Multiple transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been characterized so far.
Tag : N-6×His-ABP
Molecular Mass : 29 kDa.
AA Sequence : ITVLEQQDMWWFGEVQGQKGWFPKSYVKLISGPIRKSTSMDSGSSESPASLKRVASPAAKPVVSGEEFIAMYTYESSEQGDLTFQQGDVILVTKKDGDWW
Purity : >80% by SDS-PAGE and Coomassie blue staining
Applications : Antibody Competition
Dilutions : Antibody Competition 10 - 100 molar excess
Storage : Store at -20 centigrade. Avoid freeze-thaw cycles.
Storage Buffer : PBS and 1M Urea, pH 7.4. No Preservative.
Gene Name ITSN1 intersectin 1 [ Homo sapiens (human) ]
Official Symbol ITSN1
Synonyms ITSN1; intersectin 1; ITSN; SH3D1A; SH3P17; intersectin-1; SH3 domain-containing protein 1A; Src homology 3 domain-containing protein; human intersectin-SH3 domain-containing protein SH3P17; intersectin 1 (SH3 domain protein)
Gene ID 6453
mRNA Refseq NM_003024
Protein Refseq NP_003015
MIM 602442
UniProt ID Q15811

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITSN1 Products

Required fields are marked with *

My Review for All ITSN1 Products

Required fields are marked with *

0
cart-icon
0
compare icon