Recombinant Human ITSN1, GST-tagged

Cat.No. : ITSN1-16H
Product Overview : Recombinant Human ITSN1(588 a.a. - 675 a.a) fussed with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 588-675 a.a.
Description : The protein encoded by this gene is a cytoplasmic membrane-associated protein that indirectly coordinates endocytic membrane traffic with the actin assembly machinery. In addition, the encoded protein may regulate the formation of clathrin-coated vesicles and could be involved in synaptic vesicle recycling. This protein has been shown to interact with dynamin, CDC42, SNAP23, SNAP25, SPIN90, EPS15, EPN1, EPN2, and STN2. Multiple transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been characterized so far.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 35.42 kDa
AA Sequence : EVEKETRSKLQEIDIFNNQLKELREIHNKQQLQKQKSMEAERLKQKEQERKIIELEKQKEEAQRRAQERDKQWLE HVQQEDEHQRPRK
Applications : AP, Array, ELISA, WB-Re
Usage : For research use only (RUO)
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name ITSN1 intersectin 1 (SH3 domain protein) [ Homo sapiens ]
Official Symbol ITSN1
Synonyms ITSN; SH3D1A; SH3P17; intersectin-1; SH3 domain-containing protein 1A; Src homology 3 domain-containing protein; human intersectin-SH3 domain-containing protein SH3P17; intersectin 1 short form variant 3; intersectin 1 short form variant, 11; intersectin short variant 12
Gene ID 6453
mRNA Refseq NM_003024
Protein Refseq NP_003015
MIM 602442
UniProt ID Q15811
Chromosome Location 21q22.1-q22.2
Pathway Axon guidance, organism-specific biosystem; Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem; Developmental Biology, organism-specific biosystem
Function Rho guanyl-nucleotide exchange factor activity; calcium ion binding; guanyl-nucleotide exchange factor activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITSN1 Products

Required fields are marked with *

My Review for All ITSN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon