"CDH3" Related Products

Expand
Expand

Recombinant Human CDH3, T7/His-tagged

Cat.No.: CDH3-281H
Product Overview: The full-length extracellular domain of human CDH3 gene (108 - 645 aa) with 29 N-terminal T7/HIS-tag was expressed in E. coli.
Description: Cadherin-3, also known as P-Cadherin, is a protein that in humans is encoded by the CDH3 gene. This gene is a classical cadherin from the cadherin superfamily. The encoded protein is a calcium-dependent cell-cell adhesion glycoprotein composed of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. This gene is located in a six-cadherin cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer. In addition, aberrant expression of this protein is observed in cervical adenocarcinomas. Mutations in this gene have been associated with congential hypotrichosis with juvenile macular dystrophy.
Source: E. coli
Species: Human
Tag: T7/His
Form: 20 mM Tris-HCl buffer, containing NaCl, KCl, EDTA, L-arginine, DTT and glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFDWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSP PEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGV LPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDM DGDGSTTTAVAVVEILDANDNAPMFDPQKYEAHVPENAVGHEVQRLTVTDLDAPNSPAWRATYLIMGGDDGDHFT ITTHPESNQGILTTRKGLDFEAKNQHTLYVEVTNEAPFVLKLPTSTATIVVHVEDVNEAPVFVPPSKVVEVQEGI PTGEPVCVYTAEDPDKENQKISYRILRDPAGWLAMDPDSGQVTAVGTLDREDEQFVRNNIYEVMVLAMDNGSPPT TGTGTLLLTLIDVNDHGPVPEPRQITICNQSPVRQVLNITDKDLSPHTSPFQAQLTDDSDIYWTAEVNEEGDTVV LSLKKFLKQDTYDVHLSLSDHGNKEQLTVIRATVCDCHGHVETCPGPWKGG
Purity: ≥90% (SDS-PAGE)
Storage: Store at −20 centigrade
Concentration: 0.5 mg protein/mL
Gene Name: CDH3 cadherin 3, type 1, P-cadherin (placental) [ Homo sapiens ]
Official Symbol: CDH3
Synonyms: CDHP; HJMD; PCAD; cadherin-3; calcium-dependent adhesion protein, placental
Gene ID: 1001
mRNA Refseq: NM_001793
Protein Refseq: NP_001784
MIM: 114021
UniProt ID: P22223
Chromosome Location: 16q22.1
Pathway: Adherens junctions interactions, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem
Function: calcium ion binding; molecular_function

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.