Recombinant Human CDH3, His-tagged
Cat.No. : | CDH3-168H |
Product Overview : | Recombinant Human Cadherin-3/CDH3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu25-Gly654) of Human CDH3 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 25-654 a.a. |
Description : | Cadherin-3 (CDH3) is a single-pass type I membrane protein that belongs to the cadherin superfamily. CDH3 is a calcium-dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region, and a highly conserved cytoplasmic tail. CDH3 is expressed in some normal epithelial tissues and in some carcinoma cell lines. CDH3 preferentially interacts with themselves in a homophilic manner in connecting cells. CDH3 is involved in loss of heterozygosity events in breast and prostate cancer. Mutations in CDH3 have been associated with congential hypotrichosis with juvenile macular dystrophy. |
AA Sequence : | EPCRAVFREAEVTLEAGGAEQEPGQALGKVFMGCPGQEPALFSTDNDDFTVRNGETVQERRSLKE RNPLKIFPSKRILRRHKRDWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPP EGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDT FRGSVLEGVLPGTSVMQMTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISS GLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILDANDNAPMFDPQKYEAHVPENAVGHEVQRL TVTDLDAPNSPAWRATYLIMGGDDGDHFTITTHPESNQGILTTRKGLDFEAKNQHTLYVEVTNEA PFVLKLPTSTATIVVHVEDVNEAPVFVPPSKVVEVQEGIPTGEPVCVYTAEDPDKENQKISYRIL RDPAGWLAMDPDSGQVTAVGTLDREDEQFVRNNIYEVMVLAMDNGSPPTTGTGTLLLTLIDVNDH GPVPEPRQITICNQSPVRQVLNITDKDLSPHTSPFQAQLTDDSDIYWTAEVNEEGDTVVLSLKKF LKQDTYDVHLSLSDHGNKEQLTVIRATVCDCHGHVETCPGPWKGGVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | CDH3 cadherin 3, type 1, P-cadherin (placental) [ Homo sapiens ] |
Official Symbol | CDH3 |
Synonyms | CDH3; cadherin 3, type 1, P-cadherin (placental); cadherin 3, P cadherin (placental); cadherin-3; CDHP; PCAD; calcium-dependent adhesion protein, placental; HJMD; |
Gene ID | 1001 |
mRNA Refseq | NM_001793 |
Protein Refseq | NP_001784 |
MIM | 114021 |
UniProt ID | P22223 |
Chromosome Location | 16q22.1 |
Pathway | Adherens junctions interactions, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; |
Function | calcium ion binding; |
◆ Recombinant Proteins | ||
CDH3-3177M | Recombinant Mouse CDH3 Protein | +Inquiry |
CDH3-0272H | Recombinant Human CDH3 Protein (Glu25-Gly654), C-His-tagged | +Inquiry |
CDH3-4101HFL | Recombinant Full Length Human CDH3, Flag-tagged | +Inquiry |
CDH3-5818H | Recombinant Human CDH3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CDH3-0989H | Recombinant Human CDH3 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDH3-7636HCL | Recombinant Human CDH3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDH3 Products
Required fields are marked with *
My Review for All CDH3 Products
Required fields are marked with *