"EDC4" Related Products

Expand
Expand

Recombinant Human EDC4, GST-tagged

Cat.No.: EDC4-8392H
Product Overview: Recombinant Human EDC4(1302 a.a. - 1401 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.74 kDa
AA Sequence: PAQVFGQPPCPLSQPVLLSLIQQLASDLGTRTDLKLSYLEEAVMHLDHSDPITRDHMGSVMAQVRQKLFQFLQAE PHNSLGKAARRLSLMLHGLVTPSLP
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: EDC4 enhancer of mRNA decapping 4 [ Homo sapiens ]
Official Symbol: EDC4
Synonyms: GE1; Ge-1; RCD8; HEDL5; HEDLS; RCD-8; enhancer of mRNA-decapping protein 4; autoantigen Ge-1; autoantigen RCD-8; human enhancer of decapping large subunit
Gene ID: 23644
mRNA Refseq: NM_014329
Protein Refseq: NP_055144
MIM: 606030
UniProt ID: Q6P2E9
Chromosome Location: 16q22.1
Pathway: Deadenylation-dependent mRNA decay, organism-specific biosystem; Gene Expression, organism-specific biosystem; RNA degradation, organism-specific biosystem
Function: protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.