Recombinant Human EDC4, GST-tagged

Cat.No. : EDC4-8392H
Product Overview : Recombinant Human EDC4(1302 a.a. - 1401 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1302-1401 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : PAQVFGQPPCPLSQPVLLSLIQQLASDLGTRTDLKLSYLEEAVMHLDHSDPITRDHMGSVMAQVRQKLFQFLQAE PHNSLGKAARRLSLMLHGLVTPSLP
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name EDC4 enhancer of mRNA decapping 4 [ Homo sapiens ]
Official Symbol EDC4
Synonyms GE1; Ge-1; RCD8; HEDL5; HEDLS; RCD-8; enhancer of mRNA-decapping protein 4; autoantigen Ge-1; autoantigen RCD-8; human enhancer of decapping large subunit
Gene ID 23644
mRNA Refseq NM_014329
Protein Refseq NP_055144
MIM 606030
UniProt ID Q6P2E9
Chromosome Location 16q22.1
Pathway Deadenylation-dependent mRNA decay, organism-specific biosystem; Gene Expression, organism-specific biosystem; RNA degradation, organism-specific biosystem
Function protein binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EDC4 Products

Required fields are marked with *

My Review for All EDC4 Products

Required fields are marked with *

0
cart-icon
0
compare icon