Recombinant Human EDC4, GST-tagged EDC4-8392H

Recombinant Human EDC4, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human EDC4, GST-tagged

Recombinant Human EDC4, GST-tagged

EDC4 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : EDC4-8392H
Product Overview : Recombinant Human EDC4(1302 a.a. - 1401 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : PAQVFGQPPCPLSQPVLLSLIQQLASDLGTRTDLKLSYLEEAVMHLDHSDPITRDHMGSVMAQVRQKLFQFLQAE PHNSLGKAARRLSLMLHGLVTPSLP
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : EDC4 enhancer of mRNA decapping 4 [ Homo sapiens ]
Official Symbol : EDC4
Synonyms : GE1; Ge-1; RCD8; HEDL5; HEDLS; RCD-8; enhancer of mRNA-decapping protein 4; autoantigen Ge-1; autoantigen RCD-8; human enhancer of decapping large subunit
Gene ID : 23644
mRNA Refseq : NM_014329
Protein Refseq : NP_055144
MIM : 606030
UniProt ID : Q6P2E9
Chromosome Location : 16q22.1
Pathway : Deadenylation-dependent mRNA decay, organism-specific biosystem; Gene Expression, organism-specific biosystem; RNA degradation, organism-specific biosystem
Function : protein binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy