Recombinant Human EDC4, GST-tagged
| Cat.No. : | EDC4-8392H |
| Product Overview : | Recombinant Human EDC4(1302 a.a. - 1401 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1302-1401 a.a. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | PAQVFGQPPCPLSQPVLLSLIQQLASDLGTRTDLKLSYLEEAVMHLDHSDPITRDHMGSVMAQVRQKLFQFLQAE PHNSLGKAARRLSLMLHGLVTPSLP |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | EDC4 enhancer of mRNA decapping 4 [ Homo sapiens ] |
| Official Symbol | EDC4 |
| Synonyms | GE1; Ge-1; RCD8; HEDL5; HEDLS; RCD-8; enhancer of mRNA-decapping protein 4; autoantigen Ge-1; autoantigen RCD-8; human enhancer of decapping large subunit |
| Gene ID | 23644 |
| mRNA Refseq | NM_014329 |
| Protein Refseq | NP_055144 |
| MIM | 606030 |
| UniProt ID | Q6P2E9 |
| Chromosome Location | 16q22.1 |
| Pathway | Deadenylation-dependent mRNA decay, organism-specific biosystem; Gene Expression, organism-specific biosystem; RNA degradation, organism-specific biosystem |
| Function | protein binding |
| ◆ Recombinant Proteins | ||
| EDC4-8392H | Recombinant Human EDC4, GST-tagged | +Inquiry |
| EDC4-1665R | Recombinant Rat EDC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EDC4-2636M | Recombinant Mouse EDC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EDC4-28226TH | Recombinant Human EDC4, His-tagged | +Inquiry |
| EDC4-4136Z | Recombinant Zebrafish EDC4 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EDC4-529HCL | Recombinant Human EDC4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EDC4 Products
Required fields are marked with *
My Review for All EDC4 Products
Required fields are marked with *



