Recombinant Human EDC4, His-tagged
| Cat.No. : | EDC4-28226TH | 
| Product Overview : | Recombinant fragment, corresponding to amino acids 1143-1385 of Human EDC4 with an N-terminal His Tag, approximately 28kDa | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 1143-1385 a.a. | 
| Conjugation : | HIS | 
| Form : | Lyophilised:Reconstitution with 46 μl aqua dest. | 
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 | 
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | LGTQEYLQQLESHMKSRKAREQEAREPVLAQLRGLVSTLQ SATEQMAATVAGSVRAEVQHQLHVAVGSLQESILAQVQ RIVKGEVSVALKEQQAAVTSSIMQAMRSAAGTPVPSAHLDCQAQQAHILQLLQQGHLNQAFQQALTAADLNLVLYVCE TVDPAQVFGQPPCPLSQPVLLSLIQQLASDLGTRTDLK LSYLEEAVMHLDHSDPITRDHMGSVMAQVRQKLFQFLQAEPHNSLGKAA | 
| Sequence Similarities : | Belongs to the WD repeat EDC4 family.Contains 4 WD repeats. | 
| Gene Name | EDC4 enhancer of mRNA decapping 4 [ Homo sapiens ] | 
| Official Symbol | EDC4 | 
| Synonyms | EDC4; enhancer of mRNA decapping 4; enhancer of mRNA-decapping protein 4; Ge 1; HEDLS; RCD 8; | 
| Gene ID | 23644 | 
| mRNA Refseq | NM_014329 | 
| Protein Refseq | NP_055144 | 
| MIM | 606030 | 
| Uniprot ID | Q6P2E9 | 
| Chromosome Location | 16q22.1 | 
| Pathway | Deadenylation-dependent mRNA decay, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem; RNA degradation, organism-specific biosystem; | 
| Function | protein binding; | 
| ◆ Recombinant Proteins | ||
| EDC4-4984M | Recombinant Mouse EDC4 Protein | +Inquiry | 
| EDC4-1665R | Recombinant Rat EDC4 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| EDC4-2008R | Recombinant Rat EDC4 Protein | +Inquiry | 
| EDC4-4136Z | Recombinant Zebrafish EDC4 | +Inquiry | 
| EDC4-2636M | Recombinant Mouse EDC4 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| EDC4-529HCL | Recombinant Human EDC4 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EDC4 Products
Required fields are marked with *
My Review for All EDC4 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            